Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1995557..1996388 Replicon chromosome
Accession NZ_CP126937
Organism Escherichia coli O2:K1:H4 strain APEC E19019

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag QQA31_RS09605 Protein ID WP_000854814.1
Coordinates 1995557..1995931 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID P76364
Locus tag QQA31_RS09610 Protein ID WP_001285584.1
Coordinates 1996020..1996388 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA31_RS09565 (1990953) 1990953..1992119 + 1167 WP_001513842.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
QQA31_RS09570 (1992238) 1992238..1992711 + 474 WP_001105393.1 DNA gyrase inhibitor SbmC -
QQA31_RS09575 (1992909) 1992909..1993967 + 1059 WP_001200888.1 FUSC family protein -
QQA31_RS09580 (1994139) 1994139..1994468 + 330 WP_000450409.1 DUF496 family protein -
QQA31_RS09585 (1994569) 1994569..1994703 - 135 WP_001297944.1 EutP/PduV family microcompartment system protein -
QQA31_RS09590 (1994823) 1994823..1994951 + 129 Protein_1881 transposase domain-containing protein -
QQA31_RS09595 (1995240) 1995240..1995320 - 81 Protein_1882 hypothetical protein -
QQA31_RS09600 (1995366) 1995366..1995560 - 195 WP_000988600.1 DUF5983 family protein -
QQA31_RS09605 (1995557) 1995557..1995931 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QQA31_RS09610 (1996020) 1996020..1996388 - 369 WP_001285584.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QQA31_RS09615 (1996462) 1996462..1996683 - 222 WP_000692323.1 DUF987 domain-containing protein -
QQA31_RS09620 (1996746) 1996746..1997222 - 477 WP_001186773.1 RadC family protein -
QQA31_RS09625 (1997238) 1997238..1997717 - 480 WP_000860076.1 antirestriction protein -
QQA31_RS09630 (1997799) 1997799..1998617 - 819 WP_001234629.1 DUF932 domain-containing protein -
QQA31_RS09635 (1998717) 1998717..1998950 - 234 WP_001119729.1 DUF905 family protein -
QQA31_RS09640 (1999029) 1999029..1999484 - 456 WP_000581504.1 IrmA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T283151 WP_000854814.1 NZ_CP126937:c1995931-1995557 [Escherichia coli O2:K1:H4]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13651.52 Da        Isoelectric Point: 5.9541

>AT283151 WP_001285584.1 NZ_CP126937:c1996388-1996020 [Escherichia coli O2:K1:H4]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
PDB 2H28
AlphaFold DB A0A1M2E8G6

References