Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1191151..1191734 | Replicon | chromosome |
Accession | NZ_CP126937 | ||
Organism | Escherichia coli O2:K1:H4 strain APEC E19019 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | V0SV58 |
Locus tag | QQA31_RS05790 | Protein ID | WP_000254750.1 |
Coordinates | 1191399..1191734 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | QQA31_RS05785 | Protein ID | WP_000581937.1 |
Coordinates | 1191151..1191399 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA31_RS05775 (1187490) | 1187490..1188791 | + | 1302 | WP_000046816.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
QQA31_RS05780 (1188839) | 1188839..1191073 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
QQA31_RS05785 (1191151) | 1191151..1191399 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
QQA31_RS05790 (1191399) | 1191399..1191734 | + | 336 | WP_000254750.1 | endoribonuclease MazF | Toxin |
QQA31_RS05795 (1191806) | 1191806..1192597 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
QQA31_RS05800 (1192825) | 1192825..1194462 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
QQA31_RS05805 (1194550) | 1194550..1195848 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12067.95 Da Isoelectric Point: 8.2618
>T283149 WP_000254750.1 NZ_CP126937:1191399-1191734 [Escherichia coli O2:K1:H4]
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|