Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1022274..1022928 | Replicon | chromosome |
| Accession | NZ_CP126937 | ||
| Organism | Escherichia coli O2:K1:H4 strain APEC E19019 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | QQA31_RS05085 | Protein ID | WP_000244781.1 |
| Coordinates | 1022521..1022928 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | - |
| Locus tag | QQA31_RS05080 | Protein ID | WP_016239318.1 |
| Coordinates | 1022274..1022540 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA31_RS05060 (1018362) | 1018362..1019795 | - | 1434 | WP_001350137.1 | 6-phospho-beta-glucosidase BglA | - |
| QQA31_RS05065 (1019840) | 1019840..1020151 | + | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
| QQA31_RS05070 (1020315) | 1020315..1020974 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| QQA31_RS05075 (1021051) | 1021051..1022031 | - | 981 | WP_000886078.1 | tRNA-modifying protein YgfZ | - |
| QQA31_RS05080 (1022274) | 1022274..1022540 | + | 267 | WP_016239318.1 | FAD assembly factor SdhE | Antitoxin |
| QQA31_RS05085 (1022521) | 1022521..1022928 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
| QQA31_RS05090 (1022968) | 1022968..1023489 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| QQA31_RS05095 (1023601) | 1023601..1024497 | + | 897 | WP_000806987.1 | site-specific tyrosine recombinase XerD | - |
| QQA31_RS05100 (1024522) | 1024522..1025232 | + | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| QQA31_RS05105 (1025238) | 1025238..1026971 | + | 1734 | WP_000813190.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T283148 WP_000244781.1 NZ_CP126937:1022521-1022928 [Escherichia coli O2:K1:H4]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|