Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 906237..907038 Replicon chromosome
Accession NZ_CP126937
Organism Escherichia coli O2:K1:H4 strain APEC E19019

Toxin (Protein)


Gene name yeeV Uniprot ID D8EBK0
Locus tag QQA31_RS04455 Protein ID WP_001094436.1
Coordinates 906237..906614 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B7MN76
Locus tag QQA31_RS04460 Protein ID WP_015953067.1
Coordinates 906661..907038 (-) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA31_RS04430 (902440) 902440..902610 - 171 Protein_872 IS110 family transposase -
QQA31_RS04435 (903007) 903007..904542 - 1536 WP_083574935.1 EAL domain-containing protein -
QQA31_RS04440 (904613) 904613..905458 - 846 WP_001280513.1 DUF4942 domain-containing protein -
QQA31_RS04445 (905543) 905543..905740 - 198 WP_000839254.1 DUF957 domain-containing protein -
QQA31_RS04450 (905752) 905752..906240 - 489 WP_000761714.1 DUF5983 family protein -
QQA31_RS04455 (906237) 906237..906614 - 378 WP_001094436.1 TA system toxin CbtA family protein Toxin
QQA31_RS04460 (906661) 906661..907038 - 378 WP_015953067.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QQA31_RS04465 (907117) 907117..907338 - 222 WP_000692312.1 DUF987 domain-containing protein -
QQA31_RS04470 (907407) 907407..907883 - 477 WP_001186756.1 RadC family protein -
QQA31_RS04475 (907898) 907898..908383 - 486 WP_000860054.1 antirestriction protein -
QQA31_RS04480 (908474) 908474..909292 - 819 WP_289266541.1 DUF932 domain-containing protein -
QQA31_RS04485 (909382) 909382..909615 - 234 WP_001278287.1 DUF905 family protein -
QQA31_RS04490 (909621) 909621..910298 - 678 WP_001097312.1 hypothetical protein -
QQA31_RS04495 (910446) 910446..910901 - 456 Protein_885 WYL domain-containing protein -
QQA31_RS04500 (910943) 910943..911827 - 885 WP_083574934.1 50S ribosome-binding GTPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - rfaE / gspC / gspD / gspE / gspF / gspG / gspH / gspI / gspJ / gspK / gspL / gspM / kpsM / kpsT / neuD / neuB / neuA / neuC / neuE / kpsS / kpsC / kpsU / kpsD / kpsE / kpsF / papI / papB / papA / papH / papC / papD / papJ / papK / papE / papF / papG 765437..953144 187707
- flank IS/Tn - - 902440..902544 104


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13958.84 Da        Isoelectric Point: 6.8603

>T283147 WP_001094436.1 NZ_CP126937:c906614-906237 [Escherichia coli O2:K1:H4]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 13766.60 Da        Isoelectric Point: 6.2021

>AT283147 WP_015953067.1 NZ_CP126937:c907038-906661 [Escherichia coli O2:K1:H4]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E2L1N0

Antitoxin

Source ID Structure
AlphaFold DB A0A5Z3CIS0

References