Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 744764..745596 | Replicon | chromosome |
Accession | NZ_CP126937 | ||
Organism | Escherichia coli O2:K1:H4 strain APEC E19019 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | F4TJC5 |
Locus tag | QQA31_RS03700 | Protein ID | WP_001094452.1 |
Coordinates | 745222..745596 (+) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | F4TJC4 |
Locus tag | QQA31_RS03695 | Protein ID | WP_001285579.1 |
Coordinates | 744764..745132 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA31_RS03675 (742513) | 742513..743331 | + | 819 | WP_001564116.1 | DUF932 domain-containing protein | - |
QQA31_RS03680 (743423) | 743423..743908 | + | 486 | WP_000206669.1 | antirestriction protein | - |
QQA31_RS03685 (743924) | 743924..744400 | + | 477 | WP_001186706.1 | RadC family protein | - |
QQA31_RS03690 (744463) | 744463..744684 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
QQA31_RS03695 (744764) | 744764..745132 | + | 369 | WP_001285579.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QQA31_RS03700 (745222) | 745222..745596 | + | 375 | WP_001094452.1 | TA system toxin CbtA family protein | Toxin |
QQA31_RS03705 (745593) | 745593..746084 | + | 492 | WP_000976868.1 | DUF5983 family protein | - |
QQA31_RS03710 (746096) | 746096..746293 | + | 198 | WP_000772035.1 | DUF957 domain-containing protein | - |
QQA31_RS03715 (746390) | 746390..747235 | + | 846 | WP_021539310.1 | DUF4942 domain-containing protein | - |
QQA31_RS03725 (747535) | 747535..748041 | + | 507 | WP_000228937.1 | G/U mismatch-specific DNA glycosylase | - |
QQA31_RS03730 (748120) | 748120..749961 | - | 1842 | WP_000437380.1 | RNA polymerase sigma factor RpoD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14014.86 Da Isoelectric Point: 7.2920
>T283146 WP_001094452.1 NZ_CP126937:745222-745596 [Escherichia coli O2:K1:H4]
MNTLPDTHVREASRCSSPVTIWQTLLTRLLDQHYGLTLNDTPFSDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSTDILRARRATGLMTRDNYRTVNNITLGKHPEAK
MNTLPDTHVREASRCSSPVTIWQTLLTRLLDQHYGLTLNDTPFSDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSTDILRARRATGLMTRDNYRTVNNITLGKHPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13580.39 Da Isoelectric Point: 7.3223
>AT283146 WP_001285579.1 NZ_CP126937:744764-745132 [Escherichia coli O2:K1:H4]
VSDTLPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSCGYVYLAVYPTSETKK
VSDTLPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSCGYVYLAVYPTSETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7Z7YIM6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7Z8DWX2 |