Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 43852..44653 | Replicon | chromosome |
| Accession | NZ_CP126937 | ||
| Organism | Escherichia coli O2:K1:H4 strain APEC E19019 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0E0XS49 |
| Locus tag | QQA31_RS00230 | Protein ID | WP_001094437.1 |
| Coordinates | 43852..44229 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A0E0XTQ1 |
| Locus tag | QQA31_RS00235 | Protein ID | WP_001390338.1 |
| Coordinates | 44276..44653 (-) | Length | 126 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA31_RS00200 (39217) | 39217..40035 | + | 819 | WP_000779409.1 | lipoprotein NlpA | - |
| QQA31_RS00205 (40039) | 40039..40962 | - | 924 | WP_001351210.1 | carboxylate/amino acid/amine transporter | - |
| QQA31_RS00210 (41259) | 41259..41627 | - | 369 | WP_000509809.1 | hypothetical protein | - |
| QQA31_RS00215 (42220) | 42220..43065 | - | 846 | WP_001274561.1 | DUF4942 domain-containing protein | - |
| QQA31_RS00220 (43150) | 43150..43347 | - | 198 | WP_000772032.1 | DUF957 domain-containing protein | - |
| QQA31_RS00225 (43367) | 43367..43855 | - | 489 | WP_000761716.1 | DUF5983 family protein | - |
| QQA31_RS00230 (43852) | 43852..44229 | - | 378 | WP_001094437.1 | TA system toxin CbtA family protein | Toxin |
| QQA31_RS00235 (44276) | 44276..44653 | - | 378 | WP_001390338.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QQA31_RS00240 (44816) | 44816..45037 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QQA31_RS00245 (45100) | 45100..45576 | - | 477 | WP_001535682.1 | RadC family protein | - |
| QQA31_RS00250 (45592) | 45592..46065 | - | 474 | WP_000855064.1 | antirestriction protein | - |
| QQA31_RS00255 (46407) | 46407..47225 | - | 819 | WP_001535681.1 | DUF932 domain-containing protein | - |
| QQA31_RS00260 (47343) | 47343..47538 | - | 196 | Protein_51 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13986.90 Da Isoelectric Point: 7.3223
>T283142 WP_001094437.1 NZ_CP126937:c44229-43852 [Escherichia coli O2:K1:H4]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13745.44 Da Isoelectric Point: 5.0463
>AT283142 WP_001390338.1 NZ_CP126937:c44653-44276 [Escherichia coli O2:K1:H4]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYAYLAVYPTPAEPAITV
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYAYLAVYPTPAEPAITV
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XS49 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XTQ1 |