Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 4198282..4198877 | Replicon | chromosome |
Accession | NZ_CP126934 | ||
Organism | Escherichia coli O78:H4 strain APEC E19057 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | U9Y4M4 |
Locus tag | QQA26_RS20735 | Protein ID | WP_000239579.1 |
Coordinates | 4198527..4198877 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | U9Y2K1 |
Locus tag | QQA26_RS20730 | Protein ID | WP_001223208.1 |
Coordinates | 4198282..4198533 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA26_RS20720 (4193946) | 4193946..4197725 | + | 3780 | WP_000060921.1 | autotransporter assembly complex protein TamB | - |
QQA26_RS20725 (4197728) | 4197728..4198069 | + | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
QQA26_RS20730 (4198282) | 4198282..4198533 | + | 252 | WP_001223208.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
QQA26_RS20735 (4198527) | 4198527..4198877 | + | 351 | WP_000239579.1 | endoribonuclease toxin ChpB | Toxin |
QQA26_RS20740 (4198957) | 4198957..4199487 | - | 531 | WP_000055072.1 | inorganic diphosphatase | - |
QQA26_RS20745 (4199797) | 4199797..4200753 | + | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
QQA26_RS20750 (4201063) | 4201063..4202565 | + | 1503 | WP_000205793.1 | sugar ABC transporter ATP-binding protein | - |
QQA26_RS20755 (4202579) | 4202579..4203601 | + | 1023 | WP_001339490.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12511.45 Da Isoelectric Point: 5.6219
>T283129 WP_000239579.1 NZ_CP126934:4198527-4198877 [Escherichia coli O78:H4]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0Y8A8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LQ26 |