Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 2263915..2264540 | Replicon | chromosome |
Accession | NZ_CP126934 | ||
Organism | Escherichia coli O78:H4 strain APEC E19057 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QQA26_RS11410 | Protein ID | WP_000911330.1 |
Coordinates | 2263915..2264313 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | QQA26_RS11415 | Protein ID | WP_000450524.1 |
Coordinates | 2264313..2264540 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA26_RS11390 (2259793) | 2259793..2259993 | + | 201 | WP_000383836.1 | YpfN family protein | - |
QQA26_RS11395 (2260103) | 2260103..2260801 | - | 699 | WP_000679823.1 | esterase | - |
QQA26_RS11400 (2260875) | 2260875..2262890 | - | 2016 | WP_000829323.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
QQA26_RS11405 (2262905) | 2262905..2263768 | - | 864 | WP_001267507.1 | neutral zinc metallopeptidase | - |
QQA26_RS11410 (2263915) | 2263915..2264313 | - | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QQA26_RS11415 (2264313) | 2264313..2264540 | - | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
QQA26_RS11420 (2264694) | 2264694..2265407 | - | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
QQA26_RS11425 (2265620) | 2265620..2266654 | - | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
QQA26_RS11430 (2266671) | 2266671..2267549 | - | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
QQA26_RS11435 (2267695) | 2267695..2268267 | + | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
QQA26_RS11440 (2268267) | 2268267..2268737 | + | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T283119 WP_000911330.1 NZ_CP126934:c2264313-2263915 [Escherichia coli O78:H4]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|