Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 64014..64615 Replicon plasmid pEND_Eco 19025-2
Accession NZ_CP126933
Organism Escherichia coli O78:H51 strain APEC E19025

Toxin (Protein)


Gene name doc Uniprot ID A0A1M0S1Q8
Locus tag QQA25_RS26050 Protein ID WP_024236459.1
Coordinates 64014..64394 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag QQA25_RS26055 Protein ID WP_001190712.1
Coordinates 64394..64615 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA25_RS26020 (QQA25_26020) 59114..59233 - 120 WP_071527722.1 ash family protein -
QQA25_RS26025 (QQA25_26025) 59455..60939 - 1485 WP_000124155.1 hypothetical protein -
QQA25_RS26030 (QQA25_26030) 60939..62132 - 1194 WP_072661260.1 terminase -
QQA25_RS26035 (QQA25_26035) 62218..62670 - 453 WP_001326849.1 late promoter-activating protein -
QQA25_RS26040 (QQA25_26040) 62759..63802 - 1044 WP_001561086.1 DUF968 domain-containing protein -
QQA25_RS26045 (QQA25_26045) 63830..64009 - 180 WP_000113018.1 hypothetical protein -
QQA25_RS26050 (QQA25_26050) 64014..64394 - 381 WP_024236459.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QQA25_RS26055 (QQA25_26055) 64394..64615 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QQA25_RS26060 (QQA25_26060) 64688..65077 - 390 WP_000506727.1 S24 family peptidase -
QQA25_RS26065 (QQA25_26065) 65252..65824 + 573 WP_001133670.1 hypothetical protein -
QQA25_RS26070 (QQA25_26070) 65831..66082 - 252 Protein_74 DNA polymerase III subunit theta -
QQA25_RS26075 (QQA25_26075) 66532..66669 + 138 WP_000123562.1 hypothetical protein -
QQA25_RS26080 (QQA25_26080) 66744..67106 - 363 WP_001261544.1 hypothetical protein -
QQA25_RS26085 (QQA25_26085) 67103..67978 - 876 WP_228637137.1 hypothetical protein -
QQA25_RS26090 (QQA25_26090) 67955..68089 - 135 Protein_78 hypothetical protein -
QQA25_RS26095 (QQA25_26095) 68086..68418 - 333 WP_158212767.1 hypothetical protein -
QQA25_RS26100 (QQA25_26100) 68423..68601 - 179 Protein_80 hypothetical protein -
QQA25_RS26105 (QQA25_26105) 68603..69235 - 633 WP_001289894.1 ead/Ea22-like family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaCTX-M-125 - 1..90722 90722


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13643.37 Da        Isoelectric Point: 5.1514

>T283108 WP_024236459.1 NZ_CP126933:c64394-64014 [Escherichia coli O78:H51]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVVYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT283108 WP_001190712.1 NZ_CP126933:c64615-64394 [Escherichia coli O78:H51]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1M0S1Q8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References