283107

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 147572..148215 Replicon plasmid pEND_Eco 19025-1
Accession NZ_CP126932
Organism Escherichia coli O78:H51 strain APEC E19025

Toxin (Protein)


Gene name vagD Uniprot ID V0UN72
Locus tag QQA25_RS25625 Protein ID WP_001034044.1
Coordinates 147572..147988 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID B1P7N7
Locus tag QQA25_RS25630 Protein ID WP_001261286.1
Coordinates 147985..148215 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA25_RS25605 (142933) 142933..144474 - 1542 WP_039023592.1 IS21-like element ISEc12 family transposase -
QQA25_RS25610 (144673) 144673..144900 + 228 Protein_154 IS1 family transposase -
QQA25_RS25615 (144925) 144925..145947 - 1023 WP_000361402.1 helicase UvrD -
QQA25_RS25620 (145932) 145932..147497 - 1566 WP_001128474.1 AAA family ATPase -
QQA25_RS25625 (147572) 147572..147988 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin Toxin
QQA25_RS25630 (147985) 147985..148215 - 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QQA25_RS25635 (148819) 148819..149169 + 351 WP_000493379.1 hypothetical protein -
QQA25_RS25640 (149213) 149213..149902 + 690 WP_000796228.1 hypothetical protein -
QQA25_RS25645 (149899) 149899..150690 + 792 WP_000016494.1 site-specific integrase -
QQA25_RS25650 (150868) 150868..151221 + 354 WP_000864812.1 colicin M immunity protein -
QQA25_RS25655 (151271) 151271..152086 - 816 WP_001312845.1 lipid II-degrading bacteriocin colicin M -
QQA25_RS25660 (152330) 152330..152857 + 528 WP_000203272.1 colicin B immunity protein -
QQA25_RS25665 (152875) 152875..153042 - 168 Protein_165 colicin-B -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA / vat 1..160439 160439


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15232.66 Da        Isoelectric Point: 6.8536

>T283107 WP_001034044.1 NZ_CP126932:c147988-147572 [Escherichia coli O78:H51]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8747.86 Da        Isoelectric Point: 4.3775

>AT283107 WP_001261286.1 NZ_CP126932:c148215-147985 [Escherichia coli O78:H51]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLELEKADPDFMTEREDVVSDEGRVNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CHW1

Antitoxin

Source ID Structure
AlphaFold DB A0A829CKZ6

References