Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 134996..135531 | Replicon | plasmid pEND_Eco 19025-1 |
| Accession | NZ_CP126932 | ||
| Organism | Escherichia coli O78:H51 strain APEC E19025 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | Q3YTD6 |
| Locus tag | QQA25_RS25570 | Protein ID | WP_000222766.1 |
| Coordinates | 135244..135531 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V0VIP2 |
| Locus tag | QQA25_RS25565 | Protein ID | WP_001132900.1 |
| Coordinates | 134996..135247 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA25_RS25540 (130470) | 130470..130937 | + | 468 | Protein_140 | plasmid replication initiator RepA | - |
| QQA25_RS25545 (130990) | 130990..131667 | + | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
| QQA25_RS25550 (131667) | 131667..132014 | + | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QQA25_RS25555 (132034) | 132034..133605 | + | 1572 | WP_289257139.1 | IS66 family transposase | - |
| QQA25_RS25560 (133636) | 133636..134034 | + | 399 | Protein_144 | plasmid replication initiator RepA | - |
| QQA25_RS25565 (134996) | 134996..135247 | + | 252 | WP_001132900.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QQA25_RS25570 (135244) | 135244..135531 | + | 288 | WP_000222766.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QQA25_RS25580 (137080) | 137080..137247 | + | 168 | Protein_148 | helix-turn-helix transcriptional regulator | - |
| QQA25_RS25585 (137218) | 137218..137412 | - | 195 | Protein_149 | IS91 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA / vat | 1..160439 | 160439 | |
| - | inside | IScluster/Tn | - | - | 127857..137013 | 9156 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11147.23 Da Isoelectric Point: 10.5832
>T283106 WP_000222766.1 NZ_CP126932:135244-135531 [Escherichia coli O78:H51]
MTYTVKFRDDALKEWLKLDKTIQQQFVKKLKKCSENPHIPSAKLRGLKDCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
RERSNVYNLASERMR
MTYTVKFRDDALKEWLKLDKTIQQQFVKKLKKCSENPHIPSAKLRGLKDCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
RERSNVYNLASERMR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CDZ2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0VIP2 |