Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 118340..118965 | Replicon | plasmid pEND_Eco 19025-1 |
Accession | NZ_CP126932 | ||
Organism | Escherichia coli O78:H51 strain APEC E19025 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QQA25_RS25470 | Protein ID | WP_000911333.1 |
Coordinates | 118340..118738 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | V0VCB2 |
Locus tag | QQA25_RS25475 | Protein ID | WP_000450520.1 |
Coordinates | 118738..118965 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA25_RS25455 (114671) | 114671..115180 | + | 510 | WP_021525551.1 | conjugal transfer entry exclusion protein TraS | - |
QQA25_RS25460 (115194) | 115194..115925 | + | 732 | WP_000850422.1 | conjugal transfer complement resistance protein TraT | - |
QQA25_RS25465 (116178) | 116178..118331 | + | 2154 | Protein_125 | type IV conjugative transfer system coupling protein TraD | - |
QQA25_RS25470 (118340) | 118340..118738 | - | 399 | WP_000911333.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
QQA25_RS25475 (118738) | 118738..118965 | - | 228 | WP_000450520.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sitABCD | iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA / vat | 1..160439 | 160439 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14919.19 Da Isoelectric Point: 7.8605
>T283105 WP_000911333.1 NZ_CP126932:c118738-118340 [Escherichia coli O78:H51]
MLKFMLDTNICIFTMKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
MLKFMLDTNICIFTMKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|