Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3732099..3732936 | Replicon | chromosome |
Accession | NZ_CP126931 | ||
Organism | Escherichia coli O78:H51 strain APEC E19025 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | QQA25_RS18230 | Protein ID | WP_000227784.1 |
Coordinates | 3732394..3732936 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | QQA25_RS18225 | Protein ID | WP_001297137.1 |
Coordinates | 3732099..3732410 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA25_RS18200 (3727119) | 3727119..3728066 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
QQA25_RS18205 (3728088) | 3728088..3730079 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
QQA25_RS18210 (3730069) | 3730069..3730683 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
QQA25_RS18215 (3730683) | 3730683..3731012 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
QQA25_RS18220 (3731024) | 3731024..3731914 | + | 891 | WP_000971336.1 | heme o synthase | - |
QQA25_RS18225 (3732099) | 3732099..3732410 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
QQA25_RS18230 (3732394) | 3732394..3732936 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
QQA25_RS18235 (3732992) | 3732992..3733927 | - | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
QQA25_RS18240 (3734335) | 3734335..3735699 | + | 1365 | WP_001000978.1 | MFS transporter | - |
QQA25_RS18245 (3735827) | 3735827..3736318 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
QQA25_RS18250 (3736459) | 3736459..3737667 | + | 1209 | WP_001352368.1 | IS4-like element ISVsa5 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 3736459..3737667 | 1208 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T283095 WP_000227784.1 NZ_CP126931:3732394-3732936 [Escherichia coli O78:H51]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|