Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3698022..3698640 | Replicon | chromosome |
| Accession | NZ_CP126931 | ||
| Organism | Escherichia coli O78:H51 strain APEC E19025 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | QQA25_RS18060 | Protein ID | WP_001291435.1 |
| Coordinates | 3698422..3698640 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | QQA25_RS18055 | Protein ID | WP_000344800.1 |
| Coordinates | 3698022..3698396 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA25_RS18045 (3693111) | 3693111..3694304 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| QQA25_RS18050 (3694327) | 3694327..3697476 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
| QQA25_RS18055 (3698022) | 3698022..3698396 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| QQA25_RS18060 (3698422) | 3698422..3698640 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| QQA25_RS18065 (3698812) | 3698812..3699363 | + | 552 | WP_000102568.1 | maltose O-acetyltransferase | - |
| QQA25_RS18070 (3699479) | 3699479..3699949 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| QQA25_RS18075 (3700113) | 3700113..3701663 | + | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| QQA25_RS18080 (3701705) | 3701705..3702058 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| QQA25_RS18090 (3702437) | 3702437..3702748 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| QQA25_RS18095 (3702779) | 3702779..3703351 | - | 573 | WP_289257051.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T283094 WP_001291435.1 NZ_CP126931:3698422-3698640 [Escherichia coli O78:H51]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT283094 WP_000344800.1 NZ_CP126931:3698022-3698396 [Escherichia coli O78:H51]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |