Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1108043..1108626 | Replicon | chromosome |
Accession | NZ_CP126931 | ||
Organism | Escherichia coli O78:H51 strain APEC E19025 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | U9XFN8 |
Locus tag | QQA25_RS05380 | Protein ID | WP_000254745.1 |
Coordinates | 1108291..1108626 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | QQA25_RS05375 | Protein ID | WP_000581937.1 |
Coordinates | 1108043..1108291 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA25_RS05365 (1104382) | 1104382..1105683 | + | 1302 | WP_000046790.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
QQA25_RS05370 (1105731) | 1105731..1107965 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
QQA25_RS05375 (1108043) | 1108043..1108291 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
QQA25_RS05380 (1108291) | 1108291..1108626 | + | 336 | WP_000254745.1 | endoribonuclease MazF | Toxin |
QQA25_RS05385 (1108697) | 1108697..1109488 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
QQA25_RS05390 (1109716) | 1109716..1111353 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
QQA25_RS05395 (1111441) | 1111441..1112739 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
QQA25_RS05400 (1112795) | 1112795..1113157 | - | 363 | WP_000034929.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12158.08 Da Isoelectric Point: 8.4777
>T283084 WP_000254745.1 NZ_CP126931:1108291-1108626 [Escherichia coli O78:H51]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPYTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPYTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XYM3 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 1UB4 | |
PDB | 5CQX | |
PDB | 5CQY | |
PDB | 1MVF | |
PDB | 2MRN | |
PDB | 2MRU | |
AlphaFold DB | A0A7U9LMB4 |