Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 971710..972364 | Replicon | chromosome |
| Accession | NZ_CP126931 | ||
| Organism | Escherichia coli O78:H51 strain APEC E19025 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | F4NJ21 |
| Locus tag | QQA25_RS04765 | Protein ID | WP_000244772.1 |
| Coordinates | 971957..972364 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | QQA25_RS04760 | Protein ID | WP_000354046.1 |
| Coordinates | 971710..971976 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA25_RS04735 (966998) | 966998..967741 | + | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
| QQA25_RS04740 (967798) | 967798..969231 | - | 1434 | WP_001363803.1 | 6-phospho-beta-glucosidase BglA | - |
| QQA25_RS04745 (969276) | 969276..969587 | + | 312 | WP_001182944.1 | N(4)-acetylcytidine aminohydrolase | - |
| QQA25_RS04750 (969751) | 969751..970410 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| QQA25_RS04755 (970487) | 970487..971467 | - | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
| QQA25_RS04760 (971710) | 971710..971976 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| QQA25_RS04765 (971957) | 971957..972364 | + | 408 | WP_000244772.1 | protein YgfX | Toxin |
| QQA25_RS04770 (972404) | 972404..972925 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| QQA25_RS04775 (973037) | 973037..973933 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| QQA25_RS04780 (973958) | 973958..974668 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| QQA25_RS04785 (974674) | 974674..976407 | + | 1734 | WP_000813215.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16048.02 Da Isoelectric Point: 11.2511
>T283083 WP_000244772.1 NZ_CP126931:971957-972364 [Escherichia coli O78:H51]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XYB4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |