Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/- |
| Location | 313667..314253 | Replicon | chromosome |
| Accession | NZ_CP126931 | ||
| Organism | Escherichia coli O78:H51 strain APEC E19025 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A0H0RQZ4 |
| Locus tag | QQA25_RS01415 | Protein ID | WP_042014162.1 |
| Coordinates | 313667..313897 (+) | Length | 77 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | U9Y7E1 |
| Locus tag | QQA25_RS01420 | Protein ID | WP_000593555.1 |
| Coordinates | 313894..314253 (+) | Length | 120 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA25_RS01405 (309704) | 309704..312439 | + | 2736 | WP_000149165.1 | ribosome-associated ATPase/putative transporter RbbA | - |
| QQA25_RS01410 (312439) | 312439..313563 | + | 1125 | WP_001314210.1 | ABC transporter permease | - |
| QQA25_RS01415 (313667) | 313667..313897 | + | 231 | WP_042014162.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| QQA25_RS01420 (313894) | 313894..314253 | + | 360 | WP_000593555.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| QQA25_RS01425 (314373) | 314373..314774 | - | 402 | WP_001190062.1 | nickel-responsive transcriptional regulator NikR | - |
| QQA25_RS01430 (314780) | 314780..315586 | - | 807 | WP_000173666.1 | nickel import ATP-binding protein NikE | - |
| QQA25_RS01435 (315583) | 315583..316347 | - | 765 | WP_001136236.1 | nickel import ATP-binding protein NikD | - |
| QQA25_RS01440 (316347) | 316347..317180 | - | 834 | WP_001008963.1 | nickel ABC transporter permease subunit NikC | - |
| QQA25_RS01445 (317177) | 317177..318121 | - | 945 | WP_000947068.1 | nickel ABC transporter permease subunit NikB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 77 a.a. Molecular weight: 8419.79 Da Isoelectric Point: 8.5518
>T283079 WP_042014162.1 NZ_CP126931:313667-313897 [Escherichia coli O78:H51]
MDQLFKSPLPQGIKWTDIESLVKALGGEIKEGRGSRCKFILNMSVACFHRPHPSPDTDKGAVESVRDWLLSIGVKP
MDQLFKSPLPQGIKWTDIESLVKALGGEIKEGRGSRCKFILNMSVACFHRPHPSPDTDKGAVESVRDWLLSIGVKP
Download Length: 231 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13402.27 Da Isoelectric Point: 5.1987
>AT283079 WP_000593555.1 NZ_CP126931:313894-314253 [Escherichia coli O78:H51]
MIKLKTPNSMEIAGQPAVITYVPELNAFRGKFLGLSGYCDFVSDSIQGLQKEGELSLREYLEDCKAAGIEPYARTEKIKT
FTLRYPESLSERLNNAAAQQQVSVNTYIIETLNERLNHL
MIKLKTPNSMEIAGQPAVITYVPELNAFRGKFLGLSGYCDFVSDSIQGLQKEGELSLREYLEDCKAAGIEPYARTEKIKT
FTLRYPESLSERLNNAAAQQQVSVNTYIIETLNERLNHL
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H0RQZ4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LKZ6 |