Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 67579..68180 Replicon plasmid pEND_Eco 12053-2
Accession NZ_CP126930
Organism Escherichia coli O2:K1:H4 strain APEC E12053

Toxin (Protein)


Gene name doc Uniprot ID U9YA20
Locus tag QQA27_RS25295 Protein ID WP_001216045.1
Coordinates 67579..67959 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag QQA27_RS25300 Protein ID WP_001190712.1
Coordinates 67959..68180 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA27_RS25270 (QQA27_25270) 63019..64503 - 1485 WP_000124155.1 hypothetical protein -
QQA27_RS25275 (QQA27_25275) 64503..65696 - 1194 WP_000219604.1 terminase -
QQA27_RS25280 (QQA27_25280) 65783..66235 - 453 WP_001312282.1 late promoter-activating protein (Gp10) -
QQA27_RS25285 (QQA27_25285) 66324..67367 - 1044 WP_097412694.1 DUF968 domain-containing protein -
QQA27_RS25290 (QQA27_25290) 67395..67574 - 180 WP_000113019.1 hypothetical protein -
QQA27_RS25295 (QQA27_25295) 67579..67959 - 381 WP_001216045.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QQA27_RS25300 (QQA27_25300) 67959..68180 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QQA27_RS25305 (QQA27_25305) 68253..68642 - 390 WP_000506730.1 S24 family peptidase -
QQA27_RS25310 (QQA27_25310) 68817..69401 + 585 WP_097412695.1 DNA-binding protein -
QQA27_RS25315 (QQA27_25315) 69402..69758 + 357 WP_001062545.1 hypothetical protein -
QQA27_RS25320 (QQA27_25320) 70834..71196 - 363 WP_001261541.1 hypothetical protein -
QQA27_RS25325 (QQA27_25325) 71193..71867 - 675 WP_097412712.1 hypothetical protein -
QQA27_RS25330 (QQA27_25330) 71849..72223 - 375 WP_000988652.1 hypothetical protein -
QQA27_RS25335 (QQA27_25335) 72230..72523 - 294 WP_000267998.1 hypothetical protein -
QQA27_RS25340 (QQA27_25340) 72547..72828 - 282 WP_032317269.1 ASCH domain-containing protein -
QQA27_RS25345 (QQA27_25345) 72828..73088 - 261 WP_000969524.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..98749 98749


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(3-120)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13588.29 Da        Isoelectric Point: 5.1514

>T283078 WP_001216045.1 NZ_CP126930:c67959-67579 [Escherichia coli O2:K1:H4]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT283078 WP_001190712.1 NZ_CP126930:c68180-67959 [Escherichia coli O2:K1:H4]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CLP7

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References