Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 41749..42392 | Replicon | plasmid pEND_Eco 12053-1 |
| Accession | NZ_CP126929 | ||
| Organism | Escherichia coli O2:K1:H4 strain APEC E12053 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | V0UN72 |
| Locus tag | QQA27_RS24170 | Protein ID | WP_001034044.1 |
| Coordinates | 41976..42392 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | B1P7N7 |
| Locus tag | QQA27_RS24165 | Protein ID | WP_001261286.1 |
| Coordinates | 41749..41979 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA27_RS24150 (36886) | 36886..37116 | + | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| QQA27_RS24155 (37113) | 37113..37529 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
| QQA27_RS24160 (37574) | 37574..41368 | - | 3795 | WP_001144732.1 | hypothetical protein | - |
| QQA27_RS24165 (41749) | 41749..41979 | + | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QQA27_RS24170 (41976) | 41976..42392 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QQA27_RS24175 (42467) | 42467..44032 | + | 1566 | WP_001128474.1 | AAA family ATPase | - |
| QQA27_RS24180 (44017) | 44017..45039 | + | 1023 | WP_000361402.1 | helicase UvrD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN / vat | 1..189727 | 189727 | |
| - | flank | IS/Tn | - | - | 45293..45793 | 500 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T283074 WP_001034044.1 NZ_CP126929:41976-42392 [Escherichia coli O2:K1:H4]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CHW1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CKZ6 |