Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 36886..37529 Replicon plasmid pEND_Eco 12053-1
Accession NZ_CP126929
Organism Escherichia coli O2:K1:H4 strain APEC E12053

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag QQA27_RS24155 Protein ID WP_001034046.1
Coordinates 37113..37529 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag QQA27_RS24150 Protein ID WP_001261278.1
Coordinates 36886..37116 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA27_RS24120 (32398) 32398..32703 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB -
QQA27_RS24125 (32705) 32705..32923 - 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA -
QQA27_RS24130 (33489) 33489..34001 + 513 WP_000151784.1 hypothetical protein -
QQA27_RS24135 (34035) 34035..35168 - 1134 WP_000545987.1 DUF3800 domain-containing protein -
QQA27_RS24140 (35335) 35335..36108 - 774 WP_000905949.1 hypothetical protein -
QQA27_RS24145 (36121) 36121..36621 - 501 WP_000528932.1 HEPN family nuclease -
QQA27_RS24150 (36886) 36886..37116 + 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QQA27_RS24155 (37113) 37113..37529 + 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
QQA27_RS24160 (37574) 37574..41368 - 3795 WP_001144732.1 hypothetical protein -
QQA27_RS24165 (41749) 41749..41979 + 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
QQA27_RS24170 (41976) 41976..42392 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN / vat 1..189727 189727


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T283073 WP_001034046.1 NZ_CP126929:37113-37529 [Escherichia coli O2:K1:H4]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT283073 WP_001261278.1 NZ_CP126929:36886-37116 [Escherichia coli O2:K1:H4]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References