Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 32398..32923 | Replicon | plasmid pEND_Eco 12053-1 |
| Accession | NZ_CP126929 | ||
| Organism | Escherichia coli O2:K1:H4 strain APEC E12053 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | S1PFV8 |
| Locus tag | QQA27_RS24120 | Protein ID | WP_001159871.1 |
| Coordinates | 32398..32703 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | H9TJP1 |
| Locus tag | QQA27_RS24125 | Protein ID | WP_000813630.1 |
| Coordinates | 32705..32923 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA27_RS24105 (28354) | 28354..29559 | - | 1206 | WP_001442122.1 | AAA family ATPase | - |
| QQA27_RS24110 (30180) | 30180..30911 | + | 732 | WP_000504262.1 | replication initiation protein | - |
| QQA27_RS24115 (31591) | 31591..32397 | - | 807 | WP_000016968.1 | site-specific integrase | - |
| QQA27_RS24120 (32398) | 32398..32703 | - | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| QQA27_RS24125 (32705) | 32705..32923 | - | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| QQA27_RS24130 (33489) | 33489..34001 | + | 513 | WP_000151784.1 | hypothetical protein | - |
| QQA27_RS24135 (34035) | 34035..35168 | - | 1134 | WP_000545987.1 | DUF3800 domain-containing protein | - |
| QQA27_RS24140 (35335) | 35335..36108 | - | 774 | WP_000905949.1 | hypothetical protein | - |
| QQA27_RS24145 (36121) | 36121..36621 | - | 501 | WP_000528932.1 | HEPN family nuclease | - |
| QQA27_RS24150 (36886) | 36886..37116 | + | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| QQA27_RS24155 (37113) | 37113..37529 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN / vat | 1..189727 | 189727 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T283072 WP_001159871.1 NZ_CP126929:c32703-32398 [Escherichia coli O2:K1:H4]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CCE8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CEF5 |