Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 32398..32923 Replicon plasmid pEND_Eco 12053-1
Accession NZ_CP126929
Organism Escherichia coli O2:K1:H4 strain APEC E12053

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag QQA27_RS24120 Protein ID WP_001159871.1
Coordinates 32398..32703 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID H9TJP1
Locus tag QQA27_RS24125 Protein ID WP_000813630.1
Coordinates 32705..32923 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA27_RS24105 (28354) 28354..29559 - 1206 WP_001442122.1 AAA family ATPase -
QQA27_RS24110 (30180) 30180..30911 + 732 WP_000504262.1 replication initiation protein -
QQA27_RS24115 (31591) 31591..32397 - 807 WP_000016968.1 site-specific integrase -
QQA27_RS24120 (32398) 32398..32703 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
QQA27_RS24125 (32705) 32705..32923 - 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
QQA27_RS24130 (33489) 33489..34001 + 513 WP_000151784.1 hypothetical protein -
QQA27_RS24135 (34035) 34035..35168 - 1134 WP_000545987.1 DUF3800 domain-containing protein -
QQA27_RS24140 (35335) 35335..36108 - 774 WP_000905949.1 hypothetical protein -
QQA27_RS24145 (36121) 36121..36621 - 501 WP_000528932.1 HEPN family nuclease -
QQA27_RS24150 (36886) 36886..37116 + 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin -
QQA27_RS24155 (37113) 37113..37529 + 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN / vat 1..189727 189727


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T283072 WP_001159871.1 NZ_CP126929:c32703-32398 [Escherichia coli O2:K1:H4]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8354.27 Da        Isoelectric Point: 4.5203

>AT283072 WP_000813630.1 NZ_CP126929:c32923-32705 [Escherichia coli O2:K1:H4]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTLQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CEF5

References