Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3558907..3559525 | Replicon | chromosome |
Accession | NZ_CP126928 | ||
Organism | Escherichia coli O2:K1:H4 strain APEC E12053 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | QQA27_RS17535 | Protein ID | WP_001291435.1 |
Coordinates | 3559307..3559525 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | QQA27_RS17530 | Protein ID | WP_000344800.1 |
Coordinates | 3558907..3559281 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA27_RS17520 (3553997) | 3553997..3555190 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
QQA27_RS17525 (3555213) | 3555213..3558362 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
QQA27_RS17530 (3558907) | 3558907..3559281 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
QQA27_RS17535 (3559307) | 3559307..3559525 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
QQA27_RS17540 (3559699) | 3559699..3560250 | + | 552 | WP_000102543.1 | maltose O-acetyltransferase | - |
QQA27_RS17545 (3560366) | 3560366..3560836 | + | 471 | WP_000136192.1 | YlaC family protein | - |
QQA27_RS17550 (3561000) | 3561000..3562550 | + | 1551 | WP_001350616.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
QQA27_RS17555 (3562592) | 3562592..3562945 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
QQA27_RS17565 (3563324) | 3563324..3563635 | + | 312 | WP_000409908.1 | MGMT family protein | - |
QQA27_RS17570 (3563666) | 3563666..3564238 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T283059 WP_001291435.1 NZ_CP126928:3559307-3559525 [Escherichia coli O2:K1:H4]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT283059 WP_000344800.1 NZ_CP126928:3558907-3559281 [Escherichia coli O2:K1:H4]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |