Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1941043..1941874 Replicon chromosome
Accession NZ_CP126928
Organism Escherichia coli O2:K1:H4 strain APEC E12053

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag QQA27_RS09330 Protein ID WP_000854814.1
Coordinates 1941043..1941417 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID P76364
Locus tag QQA27_RS09335 Protein ID WP_001285584.1
Coordinates 1941506..1941874 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA27_RS09290 (1936439) 1936439..1937605 + 1167 WP_001513842.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
QQA27_RS09295 (1937724) 1937724..1938197 + 474 WP_001105393.1 DNA gyrase inhibitor SbmC -
QQA27_RS09300 (1938395) 1938395..1939453 + 1059 WP_289245890.1 FUSC family protein -
QQA27_RS09305 (1939625) 1939625..1939954 + 330 WP_000450409.1 DUF496 family protein -
QQA27_RS09310 (1940055) 1940055..1940189 - 135 WP_001297944.1 EutP/PduV family microcompartment system protein -
QQA27_RS09315 (1940309) 1940309..1940437 + 129 Protein_1826 transposase domain-containing protein -
QQA27_RS09320 (1940726) 1940726..1940806 - 81 Protein_1827 hypothetical protein -
QQA27_RS09325 (1940852) 1940852..1941046 - 195 WP_000988600.1 DUF5983 family protein -
QQA27_RS09330 (1941043) 1941043..1941417 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QQA27_RS09335 (1941506) 1941506..1941874 - 369 WP_001285584.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QQA27_RS09340 (1941948) 1941948..1942169 - 222 WP_000692323.1 DUF987 domain-containing protein -
QQA27_RS09345 (1942232) 1942232..1942708 - 477 WP_001186773.1 RadC family protein -
QQA27_RS09350 (1942724) 1942724..1943203 - 480 WP_000860076.1 antirestriction protein -
QQA27_RS09355 (1943285) 1943285..1944103 - 819 WP_159391726.1 DUF932 domain-containing protein -
QQA27_RS09360 (1944203) 1944203..1944436 - 234 WP_001119729.1 DUF905 family protein -
QQA27_RS09365 (1944515) 1944515..1944970 - 456 WP_000581504.1 IrmA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T283050 WP_000854814.1 NZ_CP126928:c1941417-1941043 [Escherichia coli O2:K1:H4]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13651.52 Da        Isoelectric Point: 5.9541

>AT283050 WP_001285584.1 NZ_CP126928:c1941874-1941506 [Escherichia coli O2:K1:H4]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
PDB 2H28
AlphaFold DB A0A1M2E8G6

References