Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 947711..948365 | Replicon | chromosome |
Accession | NZ_CP126928 | ||
Organism | Escherichia coli O2:K1:H4 strain APEC E12053 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | QQA27_RS04670 | Protein ID | WP_000244781.1 |
Coordinates | 947958..948365 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | QQA27_RS04665 | Protein ID | WP_000354046.1 |
Coordinates | 947711..947977 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA27_RS04645 (943799) | 943799..945232 | - | 1434 | WP_001350137.1 | 6-phospho-beta-glucosidase BglA | - |
QQA27_RS04650 (945277) | 945277..945588 | + | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
QQA27_RS04655 (945752) | 945752..946411 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
QQA27_RS04660 (946488) | 946488..947468 | - | 981 | WP_000886078.1 | tRNA-modifying protein YgfZ | - |
QQA27_RS04665 (947711) | 947711..947977 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
QQA27_RS04670 (947958) | 947958..948365 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
QQA27_RS04675 (948405) | 948405..948926 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
QQA27_RS04680 (949038) | 949038..949934 | + | 897 | WP_000806987.1 | site-specific tyrosine recombinase XerD | - |
QQA27_RS04685 (949959) | 949959..950669 | + | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QQA27_RS04690 (950675) | 950675..952408 | + | 1734 | WP_000813190.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T283047 WP_000244781.1 NZ_CP126928:947958-948365 [Escherichia coli O2:K1:H4]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|