283046

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 831747..832548 Replicon chromosome
Accession NZ_CP126928
Organism Escherichia coli O2:K1:H4 strain APEC E12053

Toxin (Protein)


Gene name yeeV Uniprot ID D8EBK0
Locus tag QQA27_RS04035 Protein ID WP_001094436.1
Coordinates 831747..832124 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B7MN76
Locus tag QQA27_RS04040 Protein ID WP_015953067.1
Coordinates 832171..832548 (-) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA27_RS04010 (827950) 827950..828120 - 171 Protein_788 IS110 family transposase -
QQA27_RS04015 (828517) 828517..830052 - 1536 WP_000492897.1 EAL domain-containing protein -
QQA27_RS04020 (830123) 830123..830968 - 846 WP_001280513.1 DUF4942 domain-containing protein -
QQA27_RS04025 (831053) 831053..831250 - 198 WP_000839254.1 DUF957 domain-containing protein -
QQA27_RS04030 (831262) 831262..831750 - 489 WP_000761714.1 DUF5983 family protein -
QQA27_RS04035 (831747) 831747..832124 - 378 WP_001094436.1 TA system toxin CbtA family protein Toxin
QQA27_RS04040 (832171) 832171..832548 - 378 WP_015953067.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QQA27_RS04045 (832627) 832627..832848 - 222 WP_000692312.1 DUF987 domain-containing protein -
QQA27_RS04050 (832917) 832917..833393 - 477 WP_001186756.1 RadC family protein -
QQA27_RS04055 (833408) 833408..833893 - 486 WP_000860054.1 antirestriction protein -
QQA27_RS04060 (833984) 833984..834802 - 819 WP_001175142.1 DUF932 domain-containing protein -
QQA27_RS04065 (834892) 834892..835125 - 234 WP_001278287.1 DUF905 family protein -
QQA27_RS04070 (835131) 835131..835808 - 678 WP_001097312.1 hypothetical protein -
QQA27_RS04075 (835956) 835956..836636 - 681 WP_001282927.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - rfaE / gspC / gspD / gspE / gspF / gspG / gspH / gspI / gspJ / gspK / gspL / gspM / kpsM / kpsT / neuD / neuB / neuA / neuC / neuE / kpsS / kpsC / kpsU / kpsD / kpsE / kpsF / papI / papB / papA / papH / papC / papC / papD / papJ / papK / papE / papF / papG 690947..878581 187634
- flank IS/Tn - - 827950..828054 104


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13958.84 Da        Isoelectric Point: 6.8603

>T283046 WP_001094436.1 NZ_CP126928:c832124-831747 [Escherichia coli O2:K1:H4]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 13766.60 Da        Isoelectric Point: 6.2021

>AT283046 WP_015953067.1 NZ_CP126928:c832548-832171 [Escherichia coli O2:K1:H4]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E2L1N0

Antitoxin

Source ID Structure
AlphaFold DB A0A5Z3CIS0

References