Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 138011..138546 | Replicon | plasmid pEND_Eco 19035-1 |
| Accession | NZ_CP126927 | ||
| Organism | Escherichia coli O2:K1:H5 strain APEC E19035 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | V0VJJ7 |
| Locus tag | QQA32_RS26800 | Protein ID | WP_000222760.1 |
| Coordinates | 138011..138298 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V0VIP2 |
| Locus tag | QQA32_RS26805 | Protein ID | WP_001132900.1 |
| Coordinates | 138295..138546 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA32_RS26770 (133594) | 133594..134815 | - | 1222 | Protein_130 | ISL3 family transposase | - |
| QQA32_RS26775 (134915) | 134915..135279 | + | 365 | Protein_131 | IS1 family transposase | - |
| QQA32_RS26780 (135334) | 135334..136116 | - | 783 | WP_001442137.1 | IS21-like element IS100kyp family helper ATPase IstB | - |
| QQA32_RS26785 (136113) | 136113..137135 | - | 1023 | WP_000255956.1 | IS21-like element IS100 family transposase | - |
| QQA32_RS26790 (137224) | 137224..137571 | + | 348 | Protein_134 | IS1-like element IS1A family transposase | - |
| QQA32_RS26795 (137587) | 137587..137907 | - | 321 | Protein_135 | serine acetyltransferase | - |
| QQA32_RS26800 (138011) | 138011..138298 | - | 288 | WP_000222760.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QQA32_RS26805 (138295) | 138295..138546 | - | 252 | WP_001132900.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QQA32_RS26810 (139509) | 139509..140366 | - | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| QQA32_RS26815 (140359) | 140359..140841 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| QQA32_RS26820 (140834) | 140834..140881 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| QQA32_RS26825 (140872) | 140872..141123 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| QQA32_RS26830 (141140) | 141140..141397 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| QQA32_RS26835 (141681) | 141681..141830 | - | 150 | WP_001312851.1 | Hok/Gef family protein | - |
| - (141874) | 141874..141935 | + | 62 | NuclAT_1 | - | - |
| - (141874) | 141874..141935 | + | 62 | NuclAT_1 | - | - |
| - (141874) | 141874..141935 | + | 62 | NuclAT_1 | - | - |
| - (141874) | 141874..141935 | + | 62 | NuclAT_1 | - | - |
| QQA32_RS26840 (142191) | 142191..142265 | - | 75 | Protein_144 | endonuclease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN / vat | 1..193604 | 193604 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11105.15 Da Isoelectric Point: 10.5832
>T283037 WP_000222760.1 NZ_CP126927:c138298-138011 [Escherichia coli O2:K1:H5]
MTYTVKFRDDALKEWLKLDKSIQQQFAKKLKKCSENPHIPSAKLRGLKDCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
RERSNVYNLASERMR
MTYTVKFRDDALKEWLKLDKSIQQQFAKKLKKCSENPHIPSAKLRGLKDCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
RERSNVYNLASERMR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|