Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 138011..138546 Replicon plasmid pEND_Eco 19035-1
Accession NZ_CP126927
Organism Escherichia coli O2:K1:H5 strain APEC E19035

Toxin (Protein)


Gene name relE Uniprot ID V0VJJ7
Locus tag QQA32_RS26800 Protein ID WP_000222760.1
Coordinates 138011..138298 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0VIP2
Locus tag QQA32_RS26805 Protein ID WP_001132900.1
Coordinates 138295..138546 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA32_RS26770 (133594) 133594..134815 - 1222 Protein_130 ISL3 family transposase -
QQA32_RS26775 (134915) 134915..135279 + 365 Protein_131 IS1 family transposase -
QQA32_RS26780 (135334) 135334..136116 - 783 WP_001442137.1 IS21-like element IS100kyp family helper ATPase IstB -
QQA32_RS26785 (136113) 136113..137135 - 1023 WP_000255956.1 IS21-like element IS100 family transposase -
QQA32_RS26790 (137224) 137224..137571 + 348 Protein_134 IS1-like element IS1A family transposase -
QQA32_RS26795 (137587) 137587..137907 - 321 Protein_135 serine acetyltransferase -
QQA32_RS26800 (138011) 138011..138298 - 288 WP_000222760.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QQA32_RS26805 (138295) 138295..138546 - 252 WP_001132900.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QQA32_RS26810 (139509) 139509..140366 - 858 WP_000774297.1 incFII family plasmid replication initiator RepA -
QQA32_RS26815 (140359) 140359..140841 - 483 WP_001273588.1 hypothetical protein -
QQA32_RS26820 (140834) 140834..140881 - 48 WP_229471593.1 hypothetical protein -
QQA32_RS26825 (140872) 140872..141123 + 252 WP_223195197.1 replication protein RepA -
QQA32_RS26830 (141140) 141140..141397 - 258 WP_000083845.1 replication regulatory protein RepA -
QQA32_RS26835 (141681) 141681..141830 - 150 WP_001312851.1 Hok/Gef family protein -
- (141874) 141874..141935 + 62 NuclAT_1 - -
- (141874) 141874..141935 + 62 NuclAT_1 - -
- (141874) 141874..141935 + 62 NuclAT_1 - -
- (141874) 141874..141935 + 62 NuclAT_1 - -
QQA32_RS26840 (142191) 142191..142265 - 75 Protein_144 endonuclease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN / vat 1..193604 193604


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-83)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11105.15 Da        Isoelectric Point: 10.5832

>T283037 WP_000222760.1 NZ_CP126927:c138298-138011 [Escherichia coli O2:K1:H5]
MTYTVKFRDDALKEWLKLDKSIQQQFAKKLKKCSENPHIPSAKLRGLKDCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
RERSNVYNLASERMR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9211.41 Da        Isoelectric Point: 4.0780

>AT283037 WP_001132900.1 NZ_CP126927:c138546-138295 [Escherichia coli O2:K1:H5]
MPNIILSDTSASVSELKKNPMATVSAGDGYPVAILNRNQPAFYCVPAELYERMLDALDDQELVKLVTERSNQPLHDVDLD
SYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0VJJ7

Antitoxin

Source ID Structure
AlphaFold DB V0VIP2

References