Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 9977..10620 | Replicon | plasmid pEND_Eco 19035-1 |
| Accession | NZ_CP126927 | ||
| Organism | Escherichia coli O2:K1:H5 strain APEC E19035 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | V0UN72 |
| Locus tag | QQA32_RS26165 | Protein ID | WP_001034044.1 |
| Coordinates | 10204..10620 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | B1P7N7 |
| Locus tag | QQA32_RS26160 | Protein ID | WP_001261286.1 |
| Coordinates | 9977..10207 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA32_RS26145 (5114) | 5114..5344 | + | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| QQA32_RS26150 (5341) | 5341..5757 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
| QQA32_RS26155 (5802) | 5802..9596 | - | 3795 | WP_001144732.1 | hypothetical protein | - |
| QQA32_RS26160 (9977) | 9977..10207 | + | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QQA32_RS26165 (10204) | 10204..10620 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QQA32_RS26170 (10695) | 10695..12260 | + | 1566 | WP_001128474.1 | AAA family ATPase | - |
| QQA32_RS26175 (12245) | 12245..13267 | + | 1023 | WP_103433256.1 | DNA helicase UvrD | - |
| QQA32_RS26180 (13618) | 13618..15189 | - | 1572 | WP_000381395.1 | IS66-like element ISCro1 family transposase | - |
| QQA32_RS26185 (15209) | 15209..15556 | - | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN / vat | 1..193604 | 193604 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T283036 WP_001034044.1 NZ_CP126927:10204-10620 [Escherichia coli O2:K1:H5]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CHW1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CKZ6 |