Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 9977..10620 Replicon plasmid pEND_Eco 19035-1
Accession NZ_CP126927
Organism Escherichia coli O2:K1:H5 strain APEC E19035

Toxin (Protein)


Gene name vagD Uniprot ID V0UN72
Locus tag QQA32_RS26165 Protein ID WP_001034044.1
Coordinates 10204..10620 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID B1P7N7
Locus tag QQA32_RS26160 Protein ID WP_001261286.1
Coordinates 9977..10207 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA32_RS26145 (5114) 5114..5344 + 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin -
QQA32_RS26150 (5341) 5341..5757 + 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin -
QQA32_RS26155 (5802) 5802..9596 - 3795 WP_001144732.1 hypothetical protein -
QQA32_RS26160 (9977) 9977..10207 + 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QQA32_RS26165 (10204) 10204..10620 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin Toxin
QQA32_RS26170 (10695) 10695..12260 + 1566 WP_001128474.1 AAA family ATPase -
QQA32_RS26175 (12245) 12245..13267 + 1023 WP_103433256.1 DNA helicase UvrD -
QQA32_RS26180 (13618) 13618..15189 - 1572 WP_000381395.1 IS66-like element ISCro1 family transposase -
QQA32_RS26185 (15209) 15209..15556 - 348 WP_000624622.1 IS66 family insertion sequence element accessory protein TnpB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN / vat 1..193604 193604


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15232.66 Da        Isoelectric Point: 6.8536

>T283036 WP_001034044.1 NZ_CP126927:10204-10620 [Escherichia coli O2:K1:H5]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8747.86 Da        Isoelectric Point: 4.3775

>AT283036 WP_001261286.1 NZ_CP126927:9977-10207 [Escherichia coli O2:K1:H5]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLELEKADPDFMTEREDVVSDEGRVNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CHW1

Antitoxin

Source ID Structure
AlphaFold DB A0A829CKZ6

References