Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 5114..5757 Replicon plasmid pEND_Eco 19035-1
Accession NZ_CP126927
Organism Escherichia coli O2:K1:H5 strain APEC E19035

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag QQA32_RS26150 Protein ID WP_001034046.1
Coordinates 5341..5757 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag QQA32_RS26145 Protein ID WP_001261278.1
Coordinates 5114..5344 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA32_RS26125 (1815) 1815..2516 + 702 WP_103433257.1 replication initiation protein -
QQA32_RS26130 (3196) 3196..4002 - 807 WP_021512277.1 site-specific integrase -
QQA32_RS26135 (4003) 4003..4308 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB -
QQA32_RS26140 (4310) 4310..4528 - 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA -
QQA32_RS26145 (5114) 5114..5344 + 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QQA32_RS26150 (5341) 5341..5757 + 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
QQA32_RS26155 (5802) 5802..9596 - 3795 WP_001144732.1 hypothetical protein -
QQA32_RS26160 (9977) 9977..10207 + 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
QQA32_RS26165 (10204) 10204..10620 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN / vat 1..193604 193604


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T283035 WP_001034046.1 NZ_CP126927:5341-5757 [Escherichia coli O2:K1:H5]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT283035 WP_001261278.1 NZ_CP126927:5114-5344 [Escherichia coli O2:K1:H5]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References