Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 4003..4528 | Replicon | plasmid pEND_Eco 19035-1 |
Accession | NZ_CP126927 | ||
Organism | Escherichia coli O2:K1:H5 strain APEC E19035 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | S1PFV8 |
Locus tag | QQA32_RS26135 | Protein ID | WP_001159871.1 |
Coordinates | 4003..4308 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | H9TJP1 |
Locus tag | QQA32_RS26140 | Protein ID | WP_000813630.1 |
Coordinates | 4310..4528 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA32_RS26125 (1815) | 1815..2516 | + | 702 | WP_103433257.1 | replication initiation protein | - |
QQA32_RS26130 (3196) | 3196..4002 | - | 807 | WP_021512277.1 | site-specific integrase | - |
QQA32_RS26135 (4003) | 4003..4308 | - | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
QQA32_RS26140 (4310) | 4310..4528 | - | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
QQA32_RS26145 (5114) | 5114..5344 | + | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
QQA32_RS26150 (5341) | 5341..5757 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sitABCD | iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN / vat | 1..193604 | 193604 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T283034 WP_001159871.1 NZ_CP126927:c4308-4003 [Escherichia coli O2:K1:H5]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CCE8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CEF5 |