Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4738992..4739793 | Replicon | chromosome |
| Accession | NZ_CP126926 | ||
| Organism | Escherichia coli O2:K1:H5 strain APEC E19035 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | D8EBK0 |
| Locus tag | QQA32_RS23425 | Protein ID | WP_001094436.1 |
| Coordinates | 4739416..4739793 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B7MN76 |
| Locus tag | QQA32_RS23420 | Protein ID | WP_015953067.1 |
| Coordinates | 4738992..4739369 (+) | Length | 126 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA32_RS23385 (4734324) | 4734324..4735548 | - | 1225 | Protein_4586 | hypothetical protein | - |
| QQA32_RS23390 (4735649) | 4735649..4736533 | + | 885 | WP_000010380.1 | YfjP family GTPase | - |
| QQA32_RS23395 (4736508) | 4736508..4736639 | - | 132 | WP_001349446.1 | hypothetical protein | - |
| QQA32_RS23400 (4736719) | 4736719..4737537 | + | 819 | WP_001234688.1 | DUF932 domain-containing protein | - |
| QQA32_RS23405 (4737629) | 4737629..4738114 | + | 486 | WP_071046030.1 | antirestriction protein | - |
| QQA32_RS23410 (4738129) | 4738129..4738605 | + | 477 | WP_001186188.1 | RadC family protein | - |
| QQA32_RS23415 (4738692) | 4738692..4738913 | + | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
| QQA32_RS23420 (4738992) | 4738992..4739369 | + | 378 | WP_015953067.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| QQA32_RS23425 (4739416) | 4739416..4739793 | + | 378 | WP_001094436.1 | TA system toxin CbtA family protein | Toxin |
| QQA32_RS23430 (4739790) | 4739790..4740278 | + | 489 | WP_000761714.1 | DUF5983 family protein | - |
| QQA32_RS23435 (4740290) | 4740290..4740487 | + | 198 | WP_000839254.1 | DUF957 domain-containing protein | - |
| QQA32_RS23440 (4740572) | 4740572..4741417 | + | 846 | WP_001280513.1 | DUF4942 domain-containing protein | - |
| QQA32_RS23445 (4741488) | 4741488..4743023 | + | 1536 | WP_000492897.1 | EAL domain-containing protein | - |
| QQA32_RS23450 (4743408) | 4743408..4743567 | + | 160 | Protein_4599 | integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13958.84 Da Isoelectric Point: 6.8603
>T283031 WP_001094436.1 NZ_CP126926:4739416-4739793 [Escherichia coli O2:K1:H5]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13766.60 Da Isoelectric Point: 6.2021
>AT283031 WP_015953067.1 NZ_CP126926:4738992-4739369 [Escherichia coli O2:K1:H5]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E2L1N0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5Z3CIS0 |