Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 1034629..1035283 | Replicon | chromosome |
Accession | NZ_CP126926 | ||
Organism | Escherichia coli O2:K1:H5 strain APEC E19035 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | QQA32_RS05110 | Protein ID | WP_000244781.1 |
Coordinates | 1034876..1035283 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | QQA32_RS05105 | Protein ID | WP_000354046.1 |
Coordinates | 1034629..1034895 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA32_RS05085 (1030717) | 1030717..1032150 | - | 1434 | WP_001350137.1 | 6-phospho-beta-glucosidase BglA | - |
QQA32_RS05090 (1032195) | 1032195..1032506 | + | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
QQA32_RS05095 (1032670) | 1032670..1033329 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
QQA32_RS05100 (1033406) | 1033406..1034386 | - | 981 | WP_000886078.1 | tRNA-modifying protein YgfZ | - |
QQA32_RS05105 (1034629) | 1034629..1034895 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
QQA32_RS05110 (1034876) | 1034876..1035283 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
QQA32_RS05115 (1035323) | 1035323..1035844 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
QQA32_RS05120 (1035956) | 1035956..1036852 | + | 897 | WP_000806987.1 | site-specific tyrosine recombinase XerD | - |
QQA32_RS05125 (1036877) | 1036877..1037587 | + | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QQA32_RS05130 (1037593) | 1037593..1039326 | + | 1734 | WP_000813190.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T283019 WP_000244781.1 NZ_CP126926:1034876-1035283 [Escherichia coli O2:K1:H5]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|