Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 913993..914862 Replicon chromosome
Accession NZ_CP126926
Organism Escherichia coli O2:K1:H5 strain APEC E19035

Toxin (Protein)


Gene name yeeV Uniprot ID A0A1M1ISH3
Locus tag QQA32_RS04445 Protein ID WP_039023580.1
Coordinates 913993..914403 (-) Length 137 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A0X5FMN2
Locus tag QQA32_RS04450 Protein ID WP_039023579.1
Coordinates 914494..914862 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA32_RS04415 (909351) 909351..910499 - 1149 WP_000905922.1 capsule polysaccharide export inner-membrane protein KpsE -
QQA32_RS04420 (910571) 910571..911554 - 984 WP_001331698.1 KpsF/GutQ family sugar-phosphate isomerase -
QQA32_RS04425 (912363) 912363..912533 - 171 Protein_871 IS110 family transposase -
QQA32_RS04430 (912963) 912963..913523 - 561 Protein_872 DUF4942 domain-containing protein -
QQA32_RS04435 (913668) 913668..913805 - 138 WP_096006700.1 DUF957 domain-containing protein -
QQA32_RS04440 (913881) 913881..914030 - 150 Protein_874 DUF5983 family protein -
QQA32_RS04445 (913993) 913993..914403 - 411 WP_039023580.1 TA system toxin CbtA family protein Toxin
QQA32_RS04450 (914494) 914494..914862 - 369 WP_039023579.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QQA32_RS04455 (914912) 914912..915544 - 633 Protein_877 antitoxin of toxin-antitoxin stability system -
QQA32_RS04460 (915559) 915559..915780 - 222 WP_000692315.1 DUF987 domain-containing protein -
QQA32_RS04465 (915843) 915843..916319 - 477 WP_001349449.1 RadC family protein -
QQA32_RS04470 (916334) 916334..916819 - 486 WP_171921725.1 antirestriction protein -
QQA32_RS04475 (916911) 916911..917729 - 819 WP_186179430.1 DUF932 domain-containing protein -
QQA32_RS04480 (917819) 917819..918052 - 234 WP_001278287.1 DUF905 family protein -
QQA32_RS04485 (918058) 918058..918735 - 678 WP_001097301.1 hypothetical protein -
QQA32_RS04490 (918883) 918883..919563 - 681 Protein_884 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 912363..912467 104


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 137 a.a.        Molecular weight: 15253.38 Da        Isoelectric Point: 7.2150

>T283018 WP_039023580.1 NZ_CP126926:c914403-913993 [Escherichia coli O2:K1:H5]
MKLLPDTHVREASCCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITLGSIRGRNDETFPDAGSRQR

Download         Length: 411 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13672.49 Da        Isoelectric Point: 6.7393

>AT283018 WP_039023579.1 NZ_CP126926:c914862-914494 [Escherichia coli O2:K1:H5]
VSDTLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1M1ISH3

Antitoxin

Source ID Structure
AlphaFold DB A0A0X5FMN2

References