Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 754686..755527 | Replicon | chromosome |
| Accession | NZ_CP126926 | ||
| Organism | Escherichia coli O2:K1:H5 strain APEC E19035 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1M0WJM1 |
| Locus tag | QQA32_RS03695 | Protein ID | WP_000854822.1 |
| Coordinates | 755144..755527 (+) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A243ZR83 |
| Locus tag | QQA32_RS03690 | Protein ID | WP_071587515.1 |
| Coordinates | 754686..755054 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA32_RS03660 (749753) | 749753..750499 | - | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| QQA32_RS03665 (750514) | 750514..752055 | - | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
| QQA32_RS03670 (752430) | 752430..753248 | + | 819 | WP_103433241.1 | DUF932 domain-containing protein | - |
| QQA32_RS03675 (753340) | 753340..753825 | + | 486 | WP_103433240.1 | antirestriction protein | - |
| QQA32_RS03680 (753840) | 753840..754316 | + | 477 | WP_001186742.1 | RadC family protein | - |
| QQA32_RS03685 (754385) | 754385..754606 | + | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
| QQA32_RS03690 (754686) | 754686..755054 | + | 369 | WP_071587515.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QQA32_RS03695 (755144) | 755144..755527 | + | 384 | WP_000854822.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| QQA32_RS03700 (755518) | 755518..756006 | + | 489 | WP_001177592.1 | DUF5983 family protein | - |
| QQA32_RS03705 (756018) | 756018..756215 | + | 198 | WP_000839263.1 | DUF957 domain-containing protein | - |
| QQA32_RS03710 (756312) | 756312..757157 | + | 846 | WP_001280435.1 | DUF4942 domain-containing protein | - |
| QQA32_RS03720 (757456) | 757456..757962 | + | 507 | WP_000228937.1 | G/U mismatch-specific DNA glycosylase | - |
| QQA32_RS03725 (758041) | 758041..759882 | - | 1842 | WP_000437380.1 | RNA polymerase sigma factor RpoD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14295.32 Da Isoelectric Point: 8.2830
>T283017 WP_000854822.1 NZ_CP126926:755144-755527 [Escherichia coli O2:K1:H5]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHQESKRCN
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHQESKRCN
Download Length: 384 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13631.41 Da Isoelectric Point: 6.6244
>AT283017 WP_071587515.1 NZ_CP126926:754686-755054 [Escherichia coli O2:K1:H5]
VSDTLPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLTDRAGIRGRFSDADANHLDQAFPLLMKQLELMLTSS
ELNPHRQNTVTLYVKGLTCHADTLGSCGYVYLAVYPTPEMKN
VSDTLPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLTDRAGIRGRFSDADANHLDQAFPLLMKQLELMLTSS
ELNPHRQNTVTLYVKGLTCHADTLGSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M0WJM1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A243ZR83 |