Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 43534..44332 | Replicon | chromosome |
| Accession | NZ_CP126926 | ||
| Organism | Escherichia coli O2:K1:H5 strain APEC E19035 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | QQA32_RS00230 | Protein ID | WP_021512528.1 |
| Coordinates | 43534..43911 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | QQA32_RS00235 | Protein ID | WP_021512529.1 |
| Coordinates | 43958..44332 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA32_RS00195 (38667) | 38667..38960 | - | 294 | WP_001297978.1 | protein YicS | - |
| QQA32_RS00200 (39182) | 39182..40000 | + | 819 | WP_000779409.1 | lipoprotein NlpA | - |
| QQA32_RS00205 (40004) | 40004..40927 | - | 924 | WP_001351210.1 | carboxylate/amino acid/amine transporter | - |
| QQA32_RS00210 (41224) | 41224..41592 | - | 369 | WP_000509809.1 | hypothetical protein | - |
| QQA32_RS00215 (42188) | 42188..43030 | - | 843 | WP_001696593.1 | DUF4942 domain-containing protein | - |
| QQA32_RS00220 (43115) | 43115..43312 | - | 198 | WP_086795284.1 | DUF957 domain-containing protein | - |
| QQA32_RS00225 (43388) | 43388..43537 | - | 150 | Protein_44 | DUF5983 family protein | - |
| QQA32_RS00230 (43534) | 43534..43911 | - | 378 | WP_021512528.1 | TA system toxin CbtA family protein | Toxin |
| QQA32_RS00235 (43958) | 43958..44332 | - | 375 | WP_021512529.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QQA32_RS00240 (44412) | 44412..44633 | - | 222 | WP_000692350.1 | DUF987 domain-containing protein | - |
| QQA32_RS00245 (44720) | 44720..45196 | - | 477 | WP_001186188.1 | RadC family protein | - |
| QQA32_RS00250 (45211) | 45211..45696 | - | 486 | WP_136710521.1 | antirestriction protein | - |
| QQA32_RS00255 (45788) | 45788..46606 | - | 819 | WP_103433064.1 | DUF932 domain-containing protein | - |
| QQA32_RS00260 (46686) | 46686..46817 | + | 132 | WP_001349446.1 | hypothetical protein | - |
| QQA32_RS00265 (46792) | 46792..47676 | - | 885 | WP_000010380.1 | YfjP family GTPase | - |
| QQA32_RS00270 (47777) | 47777..49001 | + | 1225 | Protein_53 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13993.91 Da Isoelectric Point: 7.9086
>T283016 WP_021512528.1 NZ_CP126926:c43911-43534 [Escherichia coli O2:K1:H5]
MKTLSDTHVREVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
MKTLSDTHVREVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13638.42 Da Isoelectric Point: 5.5051
>AT283016 WP_021512529.1 NZ_CP126926:c44332-43958 [Escherichia coli O2:K1:H5]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYVKGLTCEADTLGSCGYVYLAVYPTPAPAITS
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYVKGLTCEADTLGSCGYVYLAVYPTPAPAITS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|