Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 294672..295315 | Replicon | plasmid unnamed1 |
Accession | NZ_CP126682 | ||
Organism | Pantoea agglomerans strain FL1 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | - |
Locus tag | QPJ96_RS20160 | Protein ID | WP_161736537.1 |
Coordinates | 294899..295315 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | - |
Locus tag | QPJ96_RS20155 | Protein ID | WP_110332107.1 |
Coordinates | 294672..294902 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QPJ96_RS20140 (QPJ96_20140) | 290362..291486 | + | 1125 | WP_253417939.1 | ATP-grasp domain-containing protein | - |
QPJ96_RS20145 (QPJ96_20145) | 291636..292871 | + | 1236 | WP_285088483.1 | aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme | - |
QPJ96_RS20150 (QPJ96_20150) | 292849..294147 | + | 1299 | WP_285088485.1 | NtaA/DmoA family FMN-dependent monooxygenase | - |
QPJ96_RS20155 (QPJ96_20155) | 294672..294902 | + | 231 | WP_110332107.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QPJ96_RS20160 (QPJ96_20160) | 294899..295315 | + | 417 | WP_161736537.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QPJ96_RS20165 (QPJ96_20165) | 296271..296564 | - | 294 | WP_285088488.1 | DUF1493 family protein | - |
QPJ96_RS20170 (QPJ96_20170) | 296558..297016 | - | 459 | WP_285088857.1 | hypothetical protein | - |
QPJ96_RS20175 (QPJ96_20175) | 297164..297763 | - | 600 | WP_161736539.1 | DUF1173 family protein | - |
QPJ96_RS20180 (QPJ96_20180) | 298138..298458 | - | 321 | WP_161736540.1 | hypothetical protein | - |
QPJ96_RS20185 (QPJ96_20185) | 298574..299269 | - | 696 | WP_161736541.1 | B3/4 domain-containing protein | - |
QPJ96_RS20190 (QPJ96_20190) | 299313..299915 | + | 603 | WP_161736542.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | pla / iroN | 1..504646 | 504646 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15045.26 Da Isoelectric Point: 6.7031
>T283009 WP_161736537.1 NZ_CP126682:294899-295315 [Pantoea agglomerans]
VNTTYMLDTCICSFIMREQPEAVLKRLEQAVMRGHRIVVSAITYSEMRFGATGPKASPRHAQLVDAFCARLDAVLPWDRA
AVDATTEIKVALRQAGTSIGPNDTAIAGHAISAGAVLVTNNTREFARVPDLALEDWVY
VNTTYMLDTCICSFIMREQPEAVLKRLEQAVMRGHRIVVSAITYSEMRFGATGPKASPRHAQLVDAFCARLDAVLPWDRA
AVDATTEIKVALRQAGTSIGPNDTAIAGHAISAGAVLVTNNTREFARVPDLALEDWVY
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|