Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3035406..3036023 | Replicon | chromosome |
| Accession | NZ_CP126681 | ||
| Organism | Pantoea agglomerans strain FL1 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | E0LTU7 |
| Locus tag | QPJ96_RS14410 | Protein ID | WP_003850458.1 |
| Coordinates | 3035808..3036023 (+) | Length | 72 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | - |
| Locus tag | QPJ96_RS14405 | Protein ID | WP_161736034.1 |
| Coordinates | 3035406..3035783 (+) | Length | 126 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QPJ96_RS14375 (QPJ96_14375) | 3031726..3031980 | + | 255 | WP_033782196.1 | type B 50S ribosomal protein L31 | - |
| QPJ96_RS14380 (QPJ96_14380) | 3031992..3032132 | + | 141 | WP_009091664.1 | type B 50S ribosomal protein L36 | - |
| QPJ96_RS14385 (QPJ96_14385) | 3032180..3033058 | - | 879 | WP_285086248.1 | metal ABC transporter substrate-binding protein | - |
| QPJ96_RS14390 (QPJ96_14390) | 3033074..3033913 | - | 840 | WP_222924423.1 | metal ABC transporter permease | - |
| QPJ96_RS14395 (QPJ96_14395) | 3033910..3034578 | - | 669 | WP_222924425.1 | ABC transporter ATP-binding protein | - |
| QPJ96_RS14400 (QPJ96_14400) | 3034905..3035258 | + | 354 | WP_222924426.1 | hypothetical protein | - |
| QPJ96_RS14405 (QPJ96_14405) | 3035406..3035783 | + | 378 | WP_161736034.1 | Hha toxicity modulator TomB | Antitoxin |
| QPJ96_RS14410 (QPJ96_14410) | 3035808..3036023 | + | 216 | WP_003850458.1 | HHA domain-containing protein | Toxin |
| QPJ96_RS14420 (QPJ96_14420) | 3036446..3036766 | + | 321 | WP_161736031.1 | MGMT family protein | - |
| QPJ96_RS14425 (QPJ96_14425) | 3036796..3037353 | - | 558 | WP_033731772.1 | YbaY family lipoprotein | - |
| QPJ96_RS14430 (QPJ96_14430) | 3037544..3038407 | + | 864 | WP_161736030.1 | acyl-CoA thioesterase II | - |
| QPJ96_RS14435 (QPJ96_14435) | 3038466..3039752 | - | 1287 | WP_161736029.1 | ammonium transporter AmtB | - |
| QPJ96_RS14440 (QPJ96_14440) | 3039787..3040125 | - | 339 | WP_003850469.1 | P-II family nitrogen regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 72 a.a. Molecular weight: 8510.90 Da Isoelectric Point: 9.4825
>T283006 WP_003850458.1 NZ_CP126681:3035808-3036023 [Pantoea agglomerans]
MNKTLTKTDYLMRLRRCRSLDTLERVIEKNKYELPEDELAVFYSAADHRLAELTMNKLYDKVPGSVWKFVR
MNKTLTKTDYLMRLRRCRSLDTLERVIEKNKYELPEDELAVFYSAADHRLAELTMNKLYDKVPGSVWKFVR
Download Length: 216 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 14659.29 Da Isoelectric Point: 4.5014
>AT283006 WP_161736034.1 NZ_CP126681:3035406-3035783 [Pantoea agglomerans]
MDEYSPKRHDIAQLKYLCESLFDDSMATLTDSHHGWVNDPTSESNLQLNDLIEHIASFTMNYKIKHVEDEALISQIDEYL
DDTFMLFSNYGINSPDLQRWQRSAKRLFNLFTEECAFLHQPSHSL
MDEYSPKRHDIAQLKYLCESLFDDSMATLTDSHHGWVNDPTSESNLQLNDLIEHIASFTMNYKIKHVEDEALISQIDEYL
DDTFMLFSNYGINSPDLQRWQRSAKRLFNLFTEECAFLHQPSHSL
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|