Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 1233815..1234447 | Replicon | chromosome |
| Accession | NZ_CP126681 | ||
| Organism | Pantoea agglomerans strain FL1 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A5M7LEN8 |
| Locus tag | QPJ96_RS05960 | Protein ID | WP_052271421.1 |
| Coordinates | 1233815..1233991 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | QPJ96_RS05965 | Protein ID | WP_285088231.1 |
| Coordinates | 1234040..1234447 (+) | Length | 136 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QPJ96_RS05930 (QPJ96_05930) | 1228842..1230173 | + | 1332 | WP_285088225.1 | chromosome partitioning protein ParB | - |
| QPJ96_RS05935 (QPJ96_05935) | 1230170..1230535 | + | 366 | WP_285088226.1 | RusA family crossover junction endodeoxyribonuclease | - |
| QPJ96_RS05940 (QPJ96_05940) | 1230532..1231554 | + | 1023 | WP_285088227.1 | DUF968 domain-containing protein | - |
| QPJ96_RS05945 (QPJ96_05945) | 1231573..1231917 | + | 345 | WP_285088228.1 | antiterminator Q family protein | - |
| QPJ96_RS05950 (QPJ96_05950) | 1231945..1232832 | - | 888 | WP_285088229.1 | DUF4868 domain-containing protein | - |
| QPJ96_RS05955 (QPJ96_05955) | 1232837..1233355 | - | 519 | WP_285088230.1 | hypothetical protein | - |
| QPJ96_RS05960 (QPJ96_05960) | 1233815..1233991 | + | 177 | WP_052271421.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| QPJ96_RS05965 (QPJ96_05965) | 1234040..1234447 | + | 408 | WP_285088231.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| QPJ96_RS05970 (QPJ96_05970) | 1234602..1234955 | + | 354 | WP_285088232.1 | phage holin, lambda family | - |
| QPJ96_RS05975 (QPJ96_05975) | 1234939..1235355 | + | 417 | WP_285088233.1 | structural protein | - |
| QPJ96_RS05980 (QPJ96_05980) | 1235370..1235840 | + | 471 | WP_285088234.1 | Rz lytic protein | - |
| QPJ96_RS05985 (QPJ96_05985) | 1236077..1236391 | + | 315 | WP_285088235.1 | hypothetical protein | - |
| QPJ96_RS05990 (QPJ96_05990) | 1236381..1236755 | + | 375 | WP_167432817.1 | hypothetical protein | - |
| QPJ96_RS05995 (QPJ96_05995) | 1236884..1238341 | + | 1458 | WP_285088236.1 | glycosyltransferase family 2 protein | - |
| QPJ96_RS06000 (QPJ96_06000) | 1238326..1238946 | + | 621 | WP_285088237.1 | hypothetical protein | - |
| QPJ96_RS06005 (QPJ96_06005) | 1238924..1239232 | + | 309 | WP_285088238.1 | HNH endonuclease signature motif containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6727.86 Da Isoelectric Point: 11.4032
>T283003 WP_052271421.1 NZ_CP126681:1233815-1233991 [Pantoea agglomerans]
VKQSEFRRWLESQGVEVSNGTNHLKLRYNGKRSVMPRHPGAELKEPLRKAIMKQLGLK
VKQSEFRRWLESQGVEVSNGTNHLKLRYNGKRSVMPRHPGAELKEPLRKAIMKQLGLK
Download Length: 177 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 14677.78 Da Isoelectric Point: 4.3596
>AT283003 WP_285088231.1 NZ_CP126681:1234040-1234447 [Pantoea agglomerans]
MRYPINLEPCDGGYVVSFPDIPEALTQGDTREEALEMGLDALVTSFDFYFEDNQPVPAPGPITGDFVEVPASVSAKVLLL
NAFLASGLTQVELASRMGVKKQEVTRIFDLHHSTKIDTVQKALNALGKRLELVAA
MRYPINLEPCDGGYVVSFPDIPEALTQGDTREEALEMGLDALVTSFDFYFEDNQPVPAPGPITGDFVEVPASVSAKVLLL
NAFLASGLTQVELASRMGVKKQEVTRIFDLHHSTKIDTVQKALNALGKRLELVAA
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|