Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 2541543..2542020 Replicon chromosome
Accession NZ_CP126631
Organism Staphylococcus aureus strain 33-40

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag QPR37_RS12510 Protein ID WP_000052076.1
Coordinates 2541832..2542020 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag QPR37_RS12505 Protein ID WP_001059690.1
Coordinates 2541543..2541803 (+) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QPR37_RS12470 (QPR37_12470) 2536936..2537652 - 717 WP_031927536.1 type I 3-dehydroquinate dehydratase -
QPR37_RS12475 (QPR37_12475) 2537800..2538222 + 423 WP_109162004.1 organic hydroperoxide resistance protein -
QPR37_RS12480 (QPR37_12480) 2538620..2539114 + 495 WP_000569881.1 GNAT family N-acetyltransferase -
QPR37_RS12485 (QPR37_12485) 2539270..2539887 + 618 WP_141060065.1 LysE/ArgO family amino acid transporter -
QPR37_RS12490 (QPR37_12490) 2539960..2540541 - 582 WP_063651545.1 histidine phosphatase family protein -
QPR37_RS12495 (QPR37_12495) 2540766..2541002 + 237 WP_000368687.1 hypothetical protein -
QPR37_RS12500 (QPR37_12500) 2540999..2541202 - 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
QPR37_RS12505 (QPR37_12505) 2541543..2541803 + 261 WP_001059690.1 hypothetical protein Antitoxin
QPR37_RS12510 (QPR37_12510) 2541832..2542020 + 189 WP_000052076.1 hypothetical protein Toxin
QPR37_RS12515 (QPR37_12515) 2542208..2542777 + 570 WP_001106648.1 lipoprotein N-acylation protein LnsA -
QPR37_RS12520 (QPR37_12520) 2542865..2543149 + 285 WP_001004401.1 hypothetical protein -
QPR37_RS12525 (QPR37_12525) 2543211..2543429 + 219 WP_141060066.1 hypothetical protein -
QPR37_RS12530 (QPR37_12530) 2543927..2544127 - 201 WP_001059082.1 cold-shock protein -
QPR37_RS12535 (QPR37_12535) 2544484..2545170 - 687 WP_063651540.1 thermonuclease family protein -
QPR37_RS12540 (QPR37_12540) 2545511..2545993 - 483 WP_285146965.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T283002 WP_000052076.1 NZ_CP126631:2541832-2542020 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT283002 WP_001059690.1 NZ_CP126631:2541543-2541803 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References