Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 1516866..1517642 | Replicon | chromosome |
Accession | NZ_CP126631 | ||
Organism | Staphylococcus aureus strain 33-40 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | X5E2E6 |
Locus tag | QPR37_RS07645 | Protein ID | WP_000031108.1 |
Coordinates | 1517490..1517642 (+) | Length | 51 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | - |
Locus tag | QPR37_RS07640 | Protein ID | WP_063652486.1 |
Coordinates | 1516866..1517465 (+) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QPR37_RS07620 (QPR37_07620) | 1512781..1514238 | + | 1458 | WP_259378840.1 | ABC transporter permease subunit | - |
QPR37_RS07625 (QPR37_07625) | 1514231..1514953 | + | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
QPR37_RS07630 (QPR37_07630) | 1515104..1516231 | + | 1128 | WP_063652481.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
QPR37_RS07635 (QPR37_07635) | 1516236..1516742 | + | 507 | WP_063652483.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
QPR37_RS07640 (QPR37_07640) | 1516866..1517465 | + | 600 | WP_063652486.1 | hypothetical protein | Antitoxin |
QPR37_RS07645 (QPR37_07645) | 1517490..1517642 | + | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
QPR37_RS07650 (QPR37_07650) | 1518302..1518697 | + | 396 | WP_063652488.1 | hypothetical protein | - |
QPR37_RS07655 (QPR37_07655) | 1518893..1520278 | + | 1386 | WP_063652489.1 | class II fumarate hydratase | - |
QPR37_RS07660 (QPR37_07660) | 1520727..1521548 | - | 822 | WP_000669377.1 | RluA family pseudouridine synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T283000 WP_000031108.1 NZ_CP126631:1517490-1517642 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22357.54 Da Isoelectric Point: 5.3978
>AT283000 WP_063652486.1 NZ_CP126631:1516866-1517465 [Staphylococcus aureus]
MAMNFKVFDNSKLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNIEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSKLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNIEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|