Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_XRE(antitoxin)
Location 1445387..1446187 Replicon chromosome
Accession NZ_CP126631
Organism Staphylococcus aureus strain 33-40

Toxin (Protein)


Gene name - Uniprot ID -
Locus tag QPR37_RS07015 Protein ID WP_285146991.1
Coordinates 1445387..1445851 (-) Length 155 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A0C2LD36
Locus tag QPR37_RS07020 Protein ID WP_001260487.1
Coordinates 1445864..1446187 (-) Length 108 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QPR37_RS06995 (QPR37_06995) 1441167..1441697 + 531 WP_000184381.1 acyl-CoA thioesterase -
QPR37_RS07000 (QPR37_07000) 1441957..1443102 - 1146 WP_001622132.1 radical SAM/CxCxxxxC motif protein YfkAB -
QPR37_RS07005 (QPR37_07005) 1443147..1444193 - 1047 WP_001145719.1 tyrosine-type recombinase/integrase -
QPR37_RS07010 (QPR37_07010) 1444372..1445355 - 984 WP_000439124.1 DUF3644 domain-containing protein -
QPR37_RS07015 (QPR37_07015) 1445387..1445851 - 465 WP_285146991.1 toxin Toxin
QPR37_RS07020 (QPR37_07020) 1445864..1446187 - 324 WP_001260487.1 helix-turn-helix transcriptional regulator Antitoxin
QPR37_RS07025 (QPR37_07025) 1446352..1446600 + 249 WP_000272858.1 helix-turn-helix transcriptional regulator -
QPR37_RS07030 (QPR37_07030) 1446613..1447056 + 444 WP_000435360.1 hypothetical protein -
QPR37_RS07035 (QPR37_07035) 1447071..1447814 + 744 WP_063651068.1 phage antirepressor KilAC domain-containing protein -
QPR37_RS07040 (QPR37_07040) 1447839..1448018 + 180 WP_063651067.1 hypothetical protein -
QPR37_RS07045 (QPR37_07045) 1448008..1448247 - 240 WP_063651066.1 hypothetical protein -
QPR37_RS07050 (QPR37_07050) 1448395..1448607 - 213 WP_000461464.1 hypothetical protein -
QPR37_RS07055 (QPR37_07055) 1448678..1448899 + 222 WP_000594788.1 hypothetical protein -
QPR37_RS07060 (QPR37_07060) 1448892..1449053 + 162 WP_141060366.1 DUF1270 family protein -
QPR37_RS07065 (QPR37_07065) 1449145..1449447 + 303 WP_063651065.1 DUF2482 family protein -
QPR37_RS07070 (QPR37_07070) 1449452..1449712 + 261 WP_063651062.1 DUF1108 family protein -
QPR37_RS07075 (QPR37_07075) 1449722..1449943 + 222 WP_001077280.1 DUF2483 family protein -
QPR37_RS07080 (QPR37_07080) 1449936..1450715 + 780 WP_000139741.1 ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - lukS-PV / lukD 1443147..1487723 44576


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(8-65)


Sequences

Toxin        


Download         Length: 155 a.a.        Molecular weight: 18172.48 Da        Isoelectric Point: 4.6958

>T282996 WP_285146991.1 NZ_CP126631:c1445851-1445387 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRDFKLHHID

Download         Length: 465 bp

Antitoxin


Download         Length: 108 a.a.        Molecular weight: 12431.09 Da        Isoelectric Point: 9.3811

>AT282996 WP_001260487.1 NZ_CP126631:c1446187-1445864 [Staphylococcus aureus]
MRTSAEIGKLIKQLRKENNVNLTDFATKIGVNKSTLSRYENGSRKIPMEDIAEIANALKVTPEYLLLKNRQTENEVQHRA
AHLEGELTDDEWQRVLDYADYIRSKRK

Download         Length: 324 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0C2LD36

References