Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /HTH_XRE(antitoxin) |
| Location | 1445387..1446187 | Replicon | chromosome |
| Accession | NZ_CP126631 | ||
| Organism | Staphylococcus aureus strain 33-40 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | QPR37_RS07015 | Protein ID | WP_285146991.1 |
| Coordinates | 1445387..1445851 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | A0A0C2LD36 |
| Locus tag | QPR37_RS07020 | Protein ID | WP_001260487.1 |
| Coordinates | 1445864..1446187 (-) | Length | 108 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QPR37_RS06995 (QPR37_06995) | 1441167..1441697 | + | 531 | WP_000184381.1 | acyl-CoA thioesterase | - |
| QPR37_RS07000 (QPR37_07000) | 1441957..1443102 | - | 1146 | WP_001622132.1 | radical SAM/CxCxxxxC motif protein YfkAB | - |
| QPR37_RS07005 (QPR37_07005) | 1443147..1444193 | - | 1047 | WP_001145719.1 | tyrosine-type recombinase/integrase | - |
| QPR37_RS07010 (QPR37_07010) | 1444372..1445355 | - | 984 | WP_000439124.1 | DUF3644 domain-containing protein | - |
| QPR37_RS07015 (QPR37_07015) | 1445387..1445851 | - | 465 | WP_285146991.1 | toxin | Toxin |
| QPR37_RS07020 (QPR37_07020) | 1445864..1446187 | - | 324 | WP_001260487.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| QPR37_RS07025 (QPR37_07025) | 1446352..1446600 | + | 249 | WP_000272858.1 | helix-turn-helix transcriptional regulator | - |
| QPR37_RS07030 (QPR37_07030) | 1446613..1447056 | + | 444 | WP_000435360.1 | hypothetical protein | - |
| QPR37_RS07035 (QPR37_07035) | 1447071..1447814 | + | 744 | WP_063651068.1 | phage antirepressor KilAC domain-containing protein | - |
| QPR37_RS07040 (QPR37_07040) | 1447839..1448018 | + | 180 | WP_063651067.1 | hypothetical protein | - |
| QPR37_RS07045 (QPR37_07045) | 1448008..1448247 | - | 240 | WP_063651066.1 | hypothetical protein | - |
| QPR37_RS07050 (QPR37_07050) | 1448395..1448607 | - | 213 | WP_000461464.1 | hypothetical protein | - |
| QPR37_RS07055 (QPR37_07055) | 1448678..1448899 | + | 222 | WP_000594788.1 | hypothetical protein | - |
| QPR37_RS07060 (QPR37_07060) | 1448892..1449053 | + | 162 | WP_141060366.1 | DUF1270 family protein | - |
| QPR37_RS07065 (QPR37_07065) | 1449145..1449447 | + | 303 | WP_063651065.1 | DUF2482 family protein | - |
| QPR37_RS07070 (QPR37_07070) | 1449452..1449712 | + | 261 | WP_063651062.1 | DUF1108 family protein | - |
| QPR37_RS07075 (QPR37_07075) | 1449722..1449943 | + | 222 | WP_001077280.1 | DUF2483 family protein | - |
| QPR37_RS07080 (QPR37_07080) | 1449936..1450715 | + | 780 | WP_000139741.1 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukS-PV / lukD | 1443147..1487723 | 44576 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 18172.48 Da Isoelectric Point: 4.6958
>T282996 WP_285146991.1 NZ_CP126631:c1445851-1445387 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRDFKLHHID
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRDFKLHHID
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|