Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 1303157..1303686 | Replicon | chromosome |
| Accession | NZ_CP126631 | ||
| Organism | Staphylococcus aureus strain 33-40 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | QPR37_RS06285 | Protein ID | WP_063652353.1 |
| Coordinates | 1303324..1303686 (+) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | QPR37_RS06280 | Protein ID | WP_000948331.1 |
| Coordinates | 1303157..1303327 (+) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QPR37_RS06250 (QPR37_06250) | 1298193..1298753 | + | 561 | WP_063652345.1 | K(+)-transporting ATPase subunit C | - |
| QPR37_RS06255 (QPR37_06255) | 1298962..1299441 | + | 480 | WP_001287074.1 | hypothetical protein | - |
| QPR37_RS06260 (QPR37_06260) | 1299434..1301017 | + | 1584 | WP_063652347.1 | PH domain-containing protein | - |
| QPR37_RS06265 (QPR37_06265) | 1301004..1301495 | + | 492 | WP_078316666.1 | PH domain-containing protein | - |
| QPR37_RS06270 (QPR37_06270) | 1301499..1301858 | + | 360 | WP_000581197.1 | holo-ACP synthase | - |
| QPR37_RS06275 (QPR37_06275) | 1301924..1303072 | + | 1149 | WP_063652351.1 | alanine racemase | - |
| QPR37_RS06280 (QPR37_06280) | 1303157..1303327 | + | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| QPR37_RS06285 (QPR37_06285) | 1303324..1303686 | + | 363 | WP_063652353.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| QPR37_RS06290 (QPR37_06290) | 1304035..1305036 | + | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| QPR37_RS06295 (QPR37_06295) | 1305155..1305481 | + | 327 | WP_285159264.1 | anti-sigma factor antagonist | - |
| QPR37_RS06300 (QPR37_06300) | 1305483..1305962 | + | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
| QPR37_RS06305 (QPR37_06305) | 1305937..1306707 | + | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13469.74 Da Isoelectric Point: 10.1654
>T282995 WP_063652353.1 NZ_CP126631:1303324-1303686 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNVVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNVVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|