Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_XRE(antitoxin)
Location 2726274..2727074 Replicon chromosome
Accession NZ_CP126629
Organism Staphylococcus aureus strain 35-42

Toxin (Protein)


Gene name - Uniprot ID -
Locus tag QPL68_RS13270 Protein ID WP_285146991.1
Coordinates 2726274..2726738 (-) Length 155 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A0C2LD36
Locus tag QPL68_RS13275 Protein ID WP_001260487.1
Coordinates 2726751..2727074 (-) Length 108 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QPL68_RS13250 (QPL68_13250) 2722054..2722584 + 531 WP_000184381.1 acyl-CoA thioesterase -
QPL68_RS13255 (QPL68_13255) 2722844..2723989 - 1146 WP_001622132.1 radical SAM/CxCxxxxC motif protein YfkAB -
QPL68_RS13260 (QPL68_13260) 2724034..2725080 - 1047 WP_001145719.1 tyrosine-type recombinase/integrase -
QPL68_RS13265 (QPL68_13265) 2725259..2726242 - 984 WP_000439124.1 DUF3644 domain-containing protein -
QPL68_RS13270 (QPL68_13270) 2726274..2726738 - 465 WP_285146991.1 toxin Toxin
QPL68_RS13275 (QPL68_13275) 2726751..2727074 - 324 WP_001260487.1 helix-turn-helix transcriptional regulator Antitoxin
QPL68_RS13280 (QPL68_13280) 2727239..2727487 + 249 WP_000272858.1 helix-turn-helix transcriptional regulator -
QPL68_RS13285 (QPL68_13285) 2727500..2727943 + 444 WP_000435360.1 hypothetical protein -
QPL68_RS13290 (QPL68_13290) 2727958..2728701 + 744 WP_063651068.1 phage antirepressor KilAC domain-containing protein -
QPL68_RS13295 (QPL68_13295) 2728726..2728905 + 180 WP_063651067.1 hypothetical protein -
QPL68_RS13300 (QPL68_13300) 2728895..2729134 - 240 WP_063651066.1 hypothetical protein -
QPL68_RS13305 (QPL68_13305) 2729282..2729494 - 213 WP_000461464.1 hypothetical protein -
QPL68_RS13310 (QPL68_13310) 2729565..2729786 + 222 WP_000594788.1 hypothetical protein -
QPL68_RS13315 (QPL68_13315) 2729779..2729940 + 162 WP_141060366.1 DUF1270 family protein -
QPL68_RS13320 (QPL68_13320) 2730032..2730334 + 303 WP_063651065.1 DUF2482 family protein -
QPL68_RS13325 (QPL68_13325) 2730339..2730599 + 261 WP_063651062.1 DUF1108 family protein -
QPL68_RS13330 (QPL68_13330) 2730609..2730830 + 222 WP_001077280.1 DUF2483 family protein -
QPL68_RS13335 (QPL68_13335) 2730823..2731602 + 780 WP_000139741.1 ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2724034..2742761 18727


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(8-65)


Sequences

Toxin        


Download         Length: 155 a.a.        Molecular weight: 18172.48 Da        Isoelectric Point: 4.6958

>T282988 WP_285146991.1 NZ_CP126629:c2726738-2726274 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRDFKLHHID

Download         Length: 465 bp

Antitoxin


Download         Length: 108 a.a.        Molecular weight: 12431.09 Da        Isoelectric Point: 9.3811

>AT282988 WP_001260487.1 NZ_CP126629:c2727074-2726751 [Staphylococcus aureus]
MRTSAEIGKLIKQLRKENNVNLTDFATKIGVNKSTLSRYENGSRKIPMEDIAEIANALKVTPEYLLLKNRQTENEVQHRA
AHLEGELTDDEWQRVLDYADYIRSKRK

Download         Length: 324 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0C2LD36

References