Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2584044..2584573 | Replicon | chromosome |
| Accession | NZ_CP126629 | ||
| Organism | Staphylococcus aureus strain 35-42 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | QPL68_RS12540 | Protein ID | WP_063652353.1 |
| Coordinates | 2584211..2584573 (+) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | QPL68_RS12535 | Protein ID | WP_000948331.1 |
| Coordinates | 2584044..2584214 (+) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QPL68_RS12505 (QPL68_12505) | 2579080..2579640 | + | 561 | WP_063652345.1 | K(+)-transporting ATPase subunit C | - |
| QPL68_RS12510 (QPL68_12510) | 2579849..2580328 | + | 480 | WP_001287074.1 | hypothetical protein | - |
| QPL68_RS12515 (QPL68_12515) | 2580321..2581904 | + | 1584 | WP_063652347.1 | PH domain-containing protein | - |
| QPL68_RS12520 (QPL68_12520) | 2581891..2582382 | + | 492 | WP_078316666.1 | PH domain-containing protein | - |
| QPL68_RS12525 (QPL68_12525) | 2582386..2582745 | + | 360 | WP_000581197.1 | holo-ACP synthase | - |
| QPL68_RS12530 (QPL68_12530) | 2582811..2583959 | + | 1149 | WP_063652351.1 | alanine racemase | - |
| QPL68_RS12535 (QPL68_12535) | 2584044..2584214 | + | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| QPL68_RS12540 (QPL68_12540) | 2584211..2584573 | + | 363 | WP_063652353.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| QPL68_RS12545 (QPL68_12545) | 2584922..2585923 | + | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| QPL68_RS12550 (QPL68_12550) | 2586042..2586368 | + | 327 | WP_001052796.1 | anti-sigma factor antagonist | - |
| QPL68_RS12555 (QPL68_12555) | 2586370..2586849 | + | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
| QPL68_RS12560 (QPL68_12560) | 2586824..2587594 | + | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13469.74 Da Isoelectric Point: 10.1654
>T282987 WP_063652353.1 NZ_CP126629:2584211-2584573 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNVVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNVVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|