Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1079614..1080091 Replicon chromosome
Accession NZ_CP126629
Organism Staphylococcus aureus strain 35-42

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag QPL68_RS05285 Protein ID WP_000052076.1
Coordinates 1079903..1080091 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag QPL68_RS05280 Protein ID WP_001059690.1
Coordinates 1079614..1079874 (+) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QPL68_RS05245 (QPL68_05245) 1075007..1075723 - 717 WP_031927536.1 type I 3-dehydroquinate dehydratase -
QPL68_RS05250 (QPL68_05250) 1075871..1076293 + 423 WP_109162004.1 organic hydroperoxide resistance protein -
QPL68_RS05255 (QPL68_05255) 1076691..1077185 + 495 WP_000569881.1 GNAT family N-acetyltransferase -
QPL68_RS05260 (QPL68_05260) 1077341..1077958 + 618 WP_141060065.1 LysE/ArgO family amino acid transporter -
QPL68_RS05265 (QPL68_05265) 1078031..1078612 - 582 WP_063651545.1 histidine phosphatase family protein -
QPL68_RS05270 (QPL68_05270) 1078837..1079073 + 237 WP_000368687.1 hypothetical protein -
QPL68_RS05275 (QPL68_05275) 1079070..1079273 - 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
QPL68_RS05280 (QPL68_05280) 1079614..1079874 + 261 WP_001059690.1 hypothetical protein Antitoxin
QPL68_RS05285 (QPL68_05285) 1079903..1080091 + 189 WP_000052076.1 hypothetical protein Toxin
QPL68_RS05290 (QPL68_05290) 1080279..1080848 + 570 WP_001106648.1 lipoprotein N-acylation protein LnsA -
QPL68_RS05295 (QPL68_05295) 1080936..1081220 + 285 WP_001004401.1 hypothetical protein -
QPL68_RS05300 (QPL68_05300) 1081282..1081500 + 219 WP_141060066.1 hypothetical protein -
QPL68_RS05305 (QPL68_05305) 1081998..1082198 - 201 WP_001059082.1 cold-shock protein -
QPL68_RS05310 (QPL68_05310) 1082555..1083241 - 687 WP_063651540.1 thermonuclease family protein -
QPL68_RS05315 (QPL68_05315) 1083582..1084064 - 483 WP_285146965.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T282981 WP_000052076.1 NZ_CP126629:1079903-1080091 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT282981 WP_001059690.1 NZ_CP126629:1079614-1079874 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References