Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tsbAT/- |
| Location | 54990..55766 | Replicon | chromosome |
| Accession | NZ_CP126629 | ||
| Organism | Staphylococcus aureus strain 35-42 | ||
Toxin (Protein)
| Gene name | tsbT | Uniprot ID | X5E2E6 |
| Locus tag | QPL68_RS00410 | Protein ID | WP_000031108.1 |
| Coordinates | 55614..55766 (+) | Length | 51 a.a. |
Antitoxin (Protein)
| Gene name | tsbA | Uniprot ID | - |
| Locus tag | QPL68_RS00405 | Protein ID | WP_063652486.1 |
| Coordinates | 54990..55589 (+) | Length | 200 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QPL68_RS00385 (QPL68_00385) | 50905..52362 | + | 1458 | WP_259378840.1 | ABC transporter permease subunit | - |
| QPL68_RS00390 (QPL68_00390) | 52355..53077 | + | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
| QPL68_RS00395 (QPL68_00395) | 53228..54355 | + | 1128 | WP_063652481.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
| QPL68_RS00400 (QPL68_00400) | 54360..54866 | + | 507 | WP_063652483.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
| QPL68_RS00405 (QPL68_00405) | 54990..55589 | + | 600 | WP_063652486.1 | hypothetical protein | Antitoxin |
| QPL68_RS00410 (QPL68_00410) | 55614..55766 | + | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
| QPL68_RS00415 (QPL68_00415) | 56426..56821 | + | 396 | WP_063652488.1 | hypothetical protein | - |
| QPL68_RS00420 (QPL68_00420) | 57017..58402 | + | 1386 | WP_063652489.1 | class II fumarate hydratase | - |
| QPL68_RS00425 (QPL68_00425) | 58851..59672 | - | 822 | WP_000669377.1 | RluA family pseudouridine synthase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T282979 WP_000031108.1 NZ_CP126629:55614-55766 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22357.54 Da Isoelectric Point: 5.3978
>AT282979 WP_063652486.1 NZ_CP126629:54990-55589 [Staphylococcus aureus]
MAMNFKVFDNSKLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNIEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSKLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNIEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|