Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2100029..2100558 | Replicon | chromosome |
Accession | NZ_CP126627 | ||
Organism | Staphylococcus aureus strain 17-21 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | QPR40_RS10380 | Protein ID | WP_000621175.1 |
Coordinates | 2100029..2100391 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | QPR40_RS10385 | Protein ID | WP_000948331.1 |
Coordinates | 2100388..2100558 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QPR40_RS10360 (QPR40_10360) | 2097007..2097777 | - | 771 | WP_001041102.1 | RNA polymerase sigma factor SigB | - |
QPR40_RS10365 (QPR40_10365) | 2097752..2098231 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
QPR40_RS10370 (QPR40_10370) | 2098233..2098559 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
QPR40_RS10375 (QPR40_10375) | 2098678..2099679 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
QPR40_RS10380 (QPR40_10380) | 2100029..2100391 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QPR40_RS10385 (QPR40_10385) | 2100388..2100558 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
QPR40_RS10390 (QPR40_10390) | 2100643..2101791 | - | 1149 | WP_001281154.1 | alanine racemase | - |
QPR40_RS10395 (QPR40_10395) | 2101857..2102216 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
QPR40_RS10400 (QPR40_10400) | 2102220..2102711 | - | 492 | WP_001205912.1 | PH domain-containing protein | - |
QPR40_RS10405 (QPR40_10405) | 2102698..2104281 | - | 1584 | WP_001294622.1 | PH domain-containing protein | - |
QPR40_RS10410 (QPR40_10410) | 2104274..2104753 | - | 480 | WP_001287079.1 | hypothetical protein | - |
QPR40_RS10415 (QPR40_10415) | 2104962..2105522 | - | 561 | WP_285144186.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T282972 WP_000621175.1 NZ_CP126627:c2100391-2100029 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|