Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tsbAT/- |
| Location | 1917230..1918006 | Replicon | chromosome |
| Accession | NZ_CP126627 | ||
| Organism | Staphylococcus aureus strain 17-21 | ||
Toxin (Protein)
| Gene name | tsbT | Uniprot ID | X5E2E6 |
| Locus tag | QPR40_RS09310 | Protein ID | WP_000031108.1 |
| Coordinates | 1917230..1917382 (-) | Length | 51 a.a. |
Antitoxin (Protein)
| Gene name | tsbA | Uniprot ID | W8U4V4 |
| Locus tag | QPR40_RS09315 | Protein ID | WP_001251224.1 |
| Coordinates | 1917407..1918006 (-) | Length | 200 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QPR40_RS09295 (QPR40_09295) | 1913437..1914258 | + | 822 | WP_000669376.1 | RluA family pseudouridine synthase | - |
| QPR40_RS09300 (QPR40_09300) | 1914710..1916095 | - | 1386 | WP_285144106.1 | class II fumarate hydratase | - |
| QPR40_RS09305 (QPR40_09305) | 1916291..1916686 | - | 396 | WP_000901023.1 | hypothetical protein | - |
| QPR40_RS09310 (QPR40_09310) | 1917230..1917382 | - | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
| QPR40_RS09315 (QPR40_09315) | 1917407..1918006 | - | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
| QPR40_RS09320 (QPR40_09320) | 1918165..1918635 | - | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
| QPR40_RS09325 (QPR40_09325) | 1918640..1919767 | - | 1128 | WP_000379980.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
| QPR40_RS09330 (QPR40_09330) | 1919919..1920641 | - | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
| QPR40_RS09335 (QPR40_09335) | 1920634..1922091 | - | 1458 | WP_285144108.1 | ABC transporter permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T282971 WP_000031108.1 NZ_CP126627:c1917382-1917230 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT282971 WP_001251224.1 NZ_CP126627:c1918006-1917407 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|