Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 836653..837130 Replicon chromosome
Accession NZ_CP126627
Organism Staphylococcus aureus strain 17-21

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag QPR40_RS04025 Protein ID WP_000052076.1
Coordinates 836653..836841 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag QPR40_RS04030 Protein ID WP_001059690.1
Coordinates 836870..837130 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QPR40_RS03995 (QPR40_03995) 832695..833165 + 471 WP_000824472.1 hypothetical protein -
QPR40_RS04000 (QPR40_04000) 833506..834192 + 687 WP_001548082.1 thermonuclease family protein -
QPR40_RS04005 (QPR40_04005) 834549..834749 + 201 WP_001059082.1 cold-shock protein -
QPR40_RS04010 (QPR40_04010) 835244..835462 - 219 WP_000005884.1 hypothetical protein -
QPR40_RS04015 (QPR40_04015) 835524..835808 - 285 WP_001004394.1 hypothetical protein -
QPR40_RS04020 (QPR40_04020) 835896..836465 - 570 WP_001106653.1 lipoprotein N-acylation protein LnsA -
QPR40_RS04025 (QPR40_04025) 836653..836841 - 189 WP_000052076.1 hypothetical protein Toxin
QPR40_RS04030 (QPR40_04030) 836870..837130 - 261 WP_001059690.1 hypothetical protein Antitoxin
QPR40_RS04035 (QPR40_04035) 837471..837674 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
QPR40_RS04040 (QPR40_04040) 837671..837907 - 237 WP_000368687.1 hypothetical protein -
QPR40_RS04045 (QPR40_04045) 838132..838713 + 582 WP_001140697.1 histidine phosphatase family protein -
QPR40_RS04050 (QPR40_04050) 838786..839403 - 618 WP_000255553.1 LysE/ArgO family amino acid transporter -
QPR40_RS04055 (QPR40_04055) 839558..840052 - 495 WP_000569887.1 GNAT family N-acetyltransferase -
QPR40_RS04060 (QPR40_04060) 840451..840873 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
QPR40_RS04065 (QPR40_04065) 841021..841737 + 717 WP_000150013.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T282970 WP_000052076.1 NZ_CP126627:c836841-836653 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT282970 WP_001059690.1 NZ_CP126627:c837130-836870 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References