Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1348596..1349515 | Replicon | chromosome |
Accession | NZ_CP126576 | ||
Organism | Bacillus licheniformis strain CQMB003 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | T5HIF3 |
Locus tag | QPK28_RS06840 | Protein ID | WP_003180879.1 |
Coordinates | 1348769..1349515 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | T5HT37 |
Locus tag | QPK28_RS06835 | Protein ID | WP_003180877.1 |
Coordinates | 1348596..1348769 (-) | Length | 58 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QPK28_RS06810 | 1344021..1345118 | + | 1098 | WP_003180867.1 | mannonate dehydratase | - |
QPK28_RS06815 | 1345094..1345942 | + | 849 | WP_003180869.1 | SDR family oxidoreductase | - |
QPK28_RS06820 | 1345969..1346982 | + | 1014 | WP_011197810.1 | zinc-binding alcohol dehydrogenase family protein | - |
QPK28_RS06825 | 1347035..1348306 | + | 1272 | WP_011197811.1 | MFS transporter | - |
QPK28_RS06830 | 1348369..1348500 | - | 132 | WP_003180875.1 | hypothetical protein | - |
QPK28_RS06835 | 1348596..1348769 | - | 174 | WP_003180877.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
QPK28_RS06840 | 1348769..1349515 | - | 747 | WP_003180879.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
QPK28_RS06845 | 1349626..1350624 | - | 999 | WP_009328723.1 | inorganic phosphate transporter | - |
QPK28_RS06850 | 1350637..1351254 | - | 618 | WP_003180884.1 | DUF47 domain-containing protein | - |
QPK28_RS06855 | 1351586..1353343 | + | 1758 | WP_003180886.1 | gamma-glutamyltransferase | - |
QPK28_RS06860 | 1353472..1354116 | + | 645 | WP_009328721.1 | YesL family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29391.80 Da Isoelectric Point: 4.5367
>T282969 WP_003180879.1 NZ_CP126576:c1349515-1348769 [Bacillus licheniformis]
MLLFYQFLVWLIVLALALYVAAVWRFEKQLAEKTVAIRKTWYLLYVIGAVIYWTHDPQSIFTNPLHYLIVAVFFTLTDAF
IFLNAYFKKLGSSELATDTRMLLEENNDLLHTYQNRLKTFQYLLKNEPIHIYYGNIEAYAEGIEKLIKRFAEKMNISAAL
CEYNSEESKDHLLEHMENRFDVQEKLDRKDVYYEENGKMVLIPFSIHDFDYVMKLTSEDLVTEFDYLLFTSLTSIYDLLL
PNEEEGDD
MLLFYQFLVWLIVLALALYVAAVWRFEKQLAEKTVAIRKTWYLLYVIGAVIYWTHDPQSIFTNPLHYLIVAVFFTLTDAF
IFLNAYFKKLGSSELATDTRMLLEENNDLLHTYQNRLKTFQYLLKNEPIHIYYGNIEAYAEGIEKLIKRFAEKMNISAAL
CEYNSEESKDHLLEHMENRFDVQEKLDRKDVYYEENGKMVLIPFSIHDFDYVMKLTSEDLVTEFDYLLFTSLTSIYDLLL
PNEEEGDD
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|