Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 557936..558572 | Replicon | chromosome |
Accession | NZ_CP126576 | ||
Organism | Bacillus licheniformis strain CQMB003 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | M5P3Q9 |
Locus tag | QPK28_RS02775 | Protein ID | WP_003179128.1 |
Coordinates | 558222..558572 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | M5PDU2 |
Locus tag | QPK28_RS02770 | Protein ID | WP_006638778.1 |
Coordinates | 557936..558217 (+) | Length | 94 a.a. |
Genomic Context
Location: 553051..554532 (1482 bp)
Type: Others
Protein ID: WP_009330132.1
Type: Others
Protein ID: WP_009330132.1
Location: 555471..556430 (960 bp)
Type: Others
Protein ID: WP_152847888.1
Type: Others
Protein ID: WP_152847888.1
Location: 556655..557824 (1170 bp)
Type: Others
Protein ID: WP_025807384.1
Type: Others
Protein ID: WP_025807384.1
Location: 557936..558217 (282 bp)
Type: Antitoxin
Protein ID: WP_006638778.1
Type: Antitoxin
Protein ID: WP_006638778.1
Location: 558222..558572 (351 bp)
Type: Toxin
Protein ID: WP_003179128.1
Type: Toxin
Protein ID: WP_003179128.1
Location: 558690..559517 (828 bp)
Type: Others
Protein ID: WP_003179130.1
Type: Others
Protein ID: WP_003179130.1
Location: 559521..559886 (366 bp)
Type: Others
Protein ID: WP_003179132.1
Type: Others
Protein ID: WP_003179132.1
Location: 559889..560290 (402 bp)
Type: Others
Protein ID: WP_003179135.1
Type: Others
Protein ID: WP_003179135.1
Location: 560301..561308 (1008 bp)
Type: Others
Protein ID: WP_003179137.1
Type: Others
Protein ID: WP_003179137.1
Location: 561367..561693 (327 bp)
Type: Others
Protein ID: WP_003179140.1
Type: Others
Protein ID: WP_003179140.1
Location: 561693..562178 (486 bp)
Type: Others
Protein ID: WP_003179142.1
Type: Others
Protein ID: WP_003179142.1
Location: 562144..562935 (792 bp)
Type: Others
Protein ID: WP_003179144.1
Type: Others
Protein ID: WP_003179144.1
Location: 562932..563531 (600 bp)
Type: Others
Protein ID: WP_003179145.1
Type: Others
Protein ID: WP_003179145.1
Location: 554529..555128 (600 bp)
Type: Others
Protein ID: WP_003179118.1
Type: Others
Protein ID: WP_003179118.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QPK28_RS02750 | 553051..554532 | + | 1482 | WP_009330132.1 | PH domain-containing protein | - |
QPK28_RS02755 | 554529..555128 | - | 600 | WP_003179118.1 | rhomboid family intramembrane serine protease | - |
QPK28_RS02760 | 555471..556430 | + | 960 | WP_152847888.1 | outer membrane lipoprotein carrier protein LolA | - |
QPK28_RS02765 | 556655..557824 | + | 1170 | WP_025807384.1 | alanine racemase | - |
QPK28_RS02770 | 557936..558217 | + | 282 | WP_006638778.1 | hypothetical protein | Antitoxin |
QPK28_RS02775 | 558222..558572 | + | 351 | WP_003179128.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QPK28_RS02780 | 558690..559517 | + | 828 | WP_003179130.1 | RsbT co-antagonist protein RsbRA | - |
QPK28_RS02785 | 559521..559886 | + | 366 | WP_003179132.1 | STAS domain-containing protein | - |
QPK28_RS02790 | 559889..560290 | + | 402 | WP_003179135.1 | anti-sigma regulatory factor | - |
QPK28_RS02795 | 560301..561308 | + | 1008 | WP_003179137.1 | PP2C family protein-serine/threonine phosphatase | - |
QPK28_RS02800 | 561367..561693 | + | 327 | WP_003179140.1 | anti-sigma factor antagonist | - |
QPK28_RS02805 | 561693..562178 | + | 486 | WP_003179142.1 | anti-sigma B factor RsbW | - |
QPK28_RS02810 | 562144..562935 | + | 792 | WP_003179144.1 | RNA polymerase sigma factor SigB | - |
QPK28_RS02815 | 562932..563531 | + | 600 | WP_003179145.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12990.03 Da Isoelectric Point: 5.7234
>T282968 WP_003179128.1 NZ_CP126576:558222-558572 [Bacillus licheniformis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNNIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVNEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNNIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVNEALQISLALIDF
Download Length: 351 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6I7FHI4 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | M5PDU2 |